• Gene id: 4046

Gene Summary

• Gene Symbol: LSP1   Gene   UCSC   Ensembl
• Aliases: WP34, pp52
• Gene name: lymphocyte specific protein 1
• Alternate names: lymphocyte-specific protein 1, 47 kDa actin binding protein, 52 kDa phosphoprotein, F-actin binding and cytoskeleton associated protein, leufactin (leukocyte F-actin binding protein), leukocyte-specific protein 1, lymphocyte-specific antigen WP34,
• Gene location: 11p15.5 (1853083: 1892262)     Exons: 16     NC_000011.10
• Gene summary(Entrez): This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Al
• OMIM: 613974

Protein Summary

• Protein general information: P33241  
  • Name: Lymphocyte specific protein 1 (47 kDa actin binding protein) (52 kDa phosphoprotein) (pp52) (Lymphocyte specific antigen WP34)
  • Length: 339  
  • Mass: 37192
  • Tissue specificity: Activated T-lymphocytes.
• Sequence:

  MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPEL
  DEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDT
  VQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPIS
  KIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQK
  GGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP

• Structural information:
  • Interpro: IPR006018  IPR002211  
  • PDB: 3BH8 4NO0 4NO2
  • PDBsum: 3BH8 4NO0 4NO2
  • STRING: ENSP00000371194
• Other Databases: GeneCards:  LSP1  Malacards:  LSP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0003779	actin binding	TAS	molecular function
GO:0006968	cellular defense response	TAS	biological process
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis
hsa04625	C-type lectin receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray