• Gene id: 4043

Gene Summary

• Gene Symbol: LRPAP1   Gene   UCSC   Ensembl
• Aliases: A2MRAP, A2RAP, HBP44, MRAP, MYP23, RAP, alpha-2-MRAP
• Gene name: LDL receptor related protein associated protein 1
• Alternate names: alpha-2-macroglobulin receptor-associated protein, 39 kDa receptor-associated protein, low density lipoprotein receptor-related protein associated protein 1, low density lipoprotein-related protein-associated protein 1 (alpha-2-macroglobulin receptor-associa,
• Gene location: 4p16.3 (3532496: 3503596)     Exons: 9     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein that interacts with the low density lipoprotein (LDL) receptor-related protein and facilitates its proper folding and localization by preventing the binding of ligands. Mutations in this gene have been identified in individuals
• OMIM: 104225

Protein Summary

• Protein general information: P30533  
  • Name: Alpha 2 macroglobulin receptor associated protein (Alpha 2 MRAP) (Low density lipoprotein receptor related protein associated protein 1) (RAP)
  • Length: 357  
  • Mass: 41466
• Sequence:

  MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVR
  LAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPR
  LEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELK
  EKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEI
  AHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL

• Structural information:
  • Interpro: IPR038003  IPR010483  IPR009066  IPR038001  IPR037999   IPR036744  
  • Prosite: PS00014
  • CDD: cd14806 cd14807 cd14808
  • PDB: 1LRE 1NRE 1OP1 1OV2 2FCW 2FTU 2FYL 2P01 2P03
  • PDBsum: 1LRE 1NRE 1OP1 1OV2 2FCW 2FTU 2FYL 2P01 2P03
  • DIP: 39355
  • STRING: ENSP00000421922
• Other Databases: GeneCards:  LRPAP1  Malacards:  LRPAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	TAS	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	TAS	molecular function
GO:0150093	amyloid-beta clearance by transcytosis	IMP	biological process
GO:1900223	positive regulation of amyloid-beta clearance	TAS	biological process
GO:0002091	negative regulation of receptor internalization	IGI	biological process
GO:0060548	negative regulation of cell death	IGI	biological process
GO:0048019	receptor antagonist activity	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:1900116	extracellular negative regulation of signal transduction	TAS	biological process
GO:0070326	very-low-density lipoprotein particle receptor binding	IBA	molecular function
GO:0048237	rough endoplasmic reticulum lumen	IBA	cellular component
GO:0048019	receptor antagonist activity	IBA	molecular function
GO:0012505	endomembrane system	IBA	cellular component
GO:0005801	cis-Golgi network	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0002091	negative regulation of receptor internalization	IBA	biological process
GO:0050750	low-density lipoprotein particle receptor binding	IBA	molecular function
GO:0048259	regulation of receptor-mediated endocytosis	IBA	biological process
GO:0035473	lipase binding	IBA	molecular function
GO:0010916	negative regulation of very-low-density lipoprotein particle clearance	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0005801	cis-Golgi network	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0048237	rough endoplasmic reticulum lumen	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0050750	low-density lipoprotein particle receptor binding	IDA	molecular function
GO:0048259	regulation of receptor-mediated endocytosis	IDA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0048019	receptor antagonist activity	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0048237	rough endoplasmic reticulum lumen	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031982	vesicle	IEA	cellular component
GO:0035473	lipase binding	IEA	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IEA	molecular function
GO:0048019	receptor antagonist activity	IDA	molecular function
GO:0070326	very-low-density lipoprotein particle receptor binding	IPI	molecular function
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0010916	negative regulation of very-low-density lipoprotein particle clearance	IDA	biological process
GO:1900222	negative regulation of amyloid-beta clearance	IGI	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0048237	rough endoplasmic reticulum lumen	IEA	cellular component
GO:0031904	endosome lumen	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005796	Golgi lumen	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04979	Cholesterol metabolism

Diseases

Associated diseases	References
Myopia	KEGG:H02041
Myopia	KEGG:H02041
Alzheimer's disease	PMID:11425005
Dementia	PMID:18721259
Myocardial infarction	PMID:12394648
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)