• Gene id: 404281

Gene Summary

• Gene Symbol: YY2   Gene   UCSC   Ensembl
• Aliases: ZNF631
• Gene name: YY2 transcription factor
• Alternate names: transcription factor YY2, transcription factor yin yang 2, yin and yang 2, zinc finger protein 631,
• Gene location: Xp22.12 (21855986: 21858739)     Exons: 1     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a transcription factor that includes several Kruppel-like zinc fingers in its C-terminal region. It possesses both activation and repression domains, and it can therefore have both positive and negative effects on the t
• OMIM: 609360

Protein Summary

• Protein general information: O15391  
  • Name: Transcription factor YY2 (Yin and yang 2) (YY 2) (Zinc finger protein 631)
  • Length: 372  
  • Mass: 41347
  • Tissue specificity: Expressed in kidney, liver, spleen and testis but not in colon. {ECO
• Sequence:

  MASNEDFSITQDLEIPADIVELHDINVEPLPMEDIPTESVQYEDVDGNWIYGGHNHPPLMVLQPLFTNTGYGDHD
  QEMLMLQTQEEVVGYCDSDNQLGNDLEDQLALPDSIEDEHFQMTLASLSASAASTSTSTQSRSKKPSKKPSGKSA
  TSTEANPAGSSSSLGTRKWEQKQMQVKTLEGEFSVTMWSPNDNNDQGAVGEGQAENPPDYSEYLKGKKLPPGGLP
  GIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRR
  HQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHLRIHTGDKPFVCPFDVCNRKFAQSTNLKTHILTHVKTKNNP

• Structural information:
  • Interpro: IPR017114  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000389381
• Other Databases: GeneCards:  YY2  Malacards:  YY2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0031519	PcG protein complex	IBA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0000987	cis-regulatory region sequence-specific DNA binding	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881