• Gene id: 404203

Gene Summary

• Gene Symbol: SPINK6   Gene   UCSC   Ensembl
• Aliases: BUSI2, UNQ844
• Gene name: serine peptidase inhibitor Kazal type 6
• Alternate names: serine protease inhibitor Kazal-type 6, acrosin inhibitor, kallikrein inhibitor, protease inhibitor H,
• Gene location: 5q32 (148202793: 148215136)     Exons: 5     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene. [provided by RefSeq, Aug 2010]
• OMIM: 615868

Protein Summary

• Protein general information: Q6UWN8  
  • Name: Serine protease inhibitor Kazal type 6 (Kallikrein inhibitor)
  • Length: 80  
  • Mass: 8585
• Sequence:

  MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLK
  HPGKC

• Structural information:
  • Protein Domains: (24..8-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798"-)
  • Interpro: IPR002350  IPR036058  
  • Prosite: PS00282 PS51465
  • PDB: 2N52
  • PDBsum: 2N52
  • STRING: ENSP00000324870
• Other Databases: GeneCards:  SPINK6  Malacards:  SPINK6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007275	multicellular organism development	IBA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:1902572	negative regulation of serine-type peptidase activity	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0007417	central nervous system development	IBA	biological process
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0070268	cornification	TAS	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:1900004	negative regulation of serine-type endopeptidase activity	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)