• Gene id: 4035

Gene Summary

• Gene Symbol: LRP1   Gene   UCSC   Ensembl
• Aliases: A2MR, APOER, APR, CD91, IGFBP-3R, IGFBP3R, IGFBP3R1, KPA, LRP, LRP1A, TGFBR5
• Gene name: LDL receptor related protein 1
• Alternate names: prolow-density lipoprotein receptor-related protein 1, TbetaR-V/LRP-1/IGFBP-3 receptor, alpha-2-macroglobulin receptor, apolipoprotein E receptor, low density lipoprotein receptor-related protein 1, type V tgf-beta receptor,
• Gene location: 12q13.3 (57128400: 57213376)     Exons: 90     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the low-density lipoprotein receptor family of proteins. The encoded preproprotein is proteolytically processed by furin to generate 515 kDa and 85 kDa subunits that form the mature receptor (PMID: 8546712). This receptor is
• OMIM: 194540

Protein Summary

• Protein general information: Q07954  
  • Name: Prolow density lipoprotein receptor related protein 1 (LRP 1) (Alpha 2 macroglobulin receptor) (A2MR) (Apolipoprotein E receptor) (APOER) (CD antigen CD91) [Cleaved into: Low density lipoprotein receptor related protein 1 85 kDa subunit (LRP 85); Low dens
  • Length: 4544  
  • Mass: 504606
  • Tissue specificity: Most abundant in liver, brain and lung.
• Sequence:

  MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPN
  EHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKD
  FDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPT
  STRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
  DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTKLVDSKIVFPHGITLD
  LVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFENYLYATNSDNANAQQKTSVIRVNRFNSTEY
  QVVTRVDKGGALHIYHQRRQPRVRSHACENDQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHE
  LFLVYGKGRPGIIRGMDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDG
  IHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSR
  RGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKIVYEGPELNHAFGLCH
  HGNYLFWTEYRSGSVYRLERGVGGAPPTVTLLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSR
  QCACAEDQVLDADGVTCLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRF
  KCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPT
  CFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHAN
  CTNQATRPPGGCHTDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGVTHVCDPSVKFGCKDSARCISKAWVC
  DGDNDCEDNSDEENCESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAP
  GEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGESCRSLDPFKPFIIFSN
  RHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDNGALTSFEVVIQYGLATPEGLA
  VDWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRT
  VHRETGSGGWPNGLTVDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNT
  LAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGQGPCSHLCLINYNRTVSCACPHLMKLHKDN
  TTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDYDAREQRVYWSDVRTQAIKRAFINGTGVE
  TVVSADLPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNIS
  MANMDGSNRTLLFSGQKGPVGLAIDFPESKLYWISSGNHTINRCNLDGSGLEVIDAMRSQLGKATALAIMGDKLW
  WADQVSEKMGTCSKADGSGSVVLRNSTTLVMHMKVYDESIQLDHKGTNPCSVNNGDCSQLCLPTSETTRSCMCTA
  GYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHAENDTIYWVDMGLSTISRAK
  RDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWT
  EWGQYPRIERSRLDGTERVVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFS
  VSVFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAVANGGCQQLCLYRGR
  GQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNLNAPVQPFEDPEHMKNVIALAFDYRAGTSPG
  TPNRIFFSDIHFGNIQQINDDGSRRITIVENVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETV
  ITMSGDDHPRAFVLDECQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDK
  IERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKHVGSNMKLLRVDIPQQPMGIIAVANDTN
  SCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQDDLTCRAVNSSCRAQDEFECANGECINFSLTCDGVPHC
  KDKSDEKPSYCNSRRCKKTFRQCSNGRCVSNMLWCNGADDCGDGSDEIPCNKTACGVGEFRCRDGTCIGNSSRCN
  QFVDCEDASDEMNCSATDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNY
  FACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCGDGSDEAAHCEGKTCG
  PSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTCDDREFMCQNRQCIPKHFVCDHDRDCADGSDES
  PECEYPTCGPSEFRCANGRCLSSRQWECDGENDCHDQSDEAPKNPHCTSQEHKCNASSQFLCSSGRCVAEALLCN
  GQDDCGDSSDERGCHINECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPCSQRCINTH
  GSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVALDFDYREQMIYWTD
  VTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLREPRAL
  VVDVQNGYLYWTDWGDHSLIGRIGMDGSSRSVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHV
  VLSQDIPHIFALTLFEDYVYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNGG
  CSNLCLLSPGGGHKCACPTNFYLGSDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCGDHSDEPPDCPEFKCR
  PGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDCPE
  VTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSD
  EPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDC
  ADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEFQCNNTLCKPLAWKCDG
  EDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDGTDEEDCEPPTAHTTHCKDKKEFLCR
  NQRCLSSSLRCNMFDDCGDGSDEEDCSIDPKLTSCATNASICGDEARCVRTEKAAYCACRSGFHTVPGQPGCQDI
  NECLRFGTCSQLCNNTKGGHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESV
  RIDAMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVYWT
  DSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDNIQWPTGL
  AVDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVN
  LTGGLSHASDVVLYHQHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTC
  NLQCFNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCAGY
  CANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGSRCEVNKCSRCLEG
  ACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVFSQQQPGHIASIL
  IPLLLLLLLVLVAGVVFWYKRRVQGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPT
  NFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA

• Structural information:
  • Protein Domains: (25..6-)
    A (/note="LDL-receptor-class)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00124-)
    (70..11-)
    A (/note="LDL-receptor-class)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00124-)
    (111..14-)
    (/note="EGF-like-1)
    (/evidence="ECO:00-)
  • Interpro: IPR011042  IPR026823  IPR032485  IPR001881  IPR013032   IPR000742  IPR000152  IPR018097  IPR009030  IPR036055  IPR023415  IPR000033  IPR002172  
  • Prosite: PS00010 PS00022 PS01186 PS50026 PS01187 PS01209 PS50068 PS51120
  • CDD: cd00112
  • PDB: 1CR8 1D2L 1J8E 2FYJ 2FYL 2KNX 2KNY
  • PDBsum: 1CR8 1D2L 1J8E 2FYJ 2FYL 2KNX 2KNY
  • DIP: 50613
  • STRING: ENSP00000243077
• Other Databases: GeneCards:  LRP1  Malacards:  LRP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	IC	molecular function
GO:1905049	negative regulation of metallopeptidase activity	IC	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0005041	low-density lipoprotein particle receptor activity	TAS	molecular function
GO:0043395	heparan sulfate proteoglycan binding	TAS	molecular function
GO:0005044	scavenger receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016964	alpha-2 macroglobulin receptor activity	TAS	molecular function
GO:0038024	cargo receptor activity	ISS	molecular function
GO:0038024	cargo receptor activity	IMP	molecular function
GO:0038024	cargo receptor activity	IMP	molecular function
GO:0032050	clathrin heavy chain binding	IPI	molecular function
GO:1904300	positive regulation of transcytosis	ISS	biological process
GO:0006909	phagocytosis	NAS	biological process
GO:0006909	phagocytosis	IMP	biological process
GO:1904646	cellular response to amyloid-beta	ISS	biological process
GO:0030226	apolipoprotein receptor activity	TAS	molecular function
GO:0150093	amyloid-beta clearance by transcytosis	IGI	biological process
GO:0006629	lipid metabolic process	TAS	biological process
GO:0006898	receptor-mediated endocytosis	IMP	biological process
GO:0006898	receptor-mediated endocytosis	ISS	biological process
GO:0006898	receptor-mediated endocytosis	ISS	biological process
GO:0006898	receptor-mediated endocytosis	ISS	biological process
GO:0006898	receptor-mediated endocytosis	IMP	biological process
GO:0006898	receptor-mediated endocytosis	IMP	biological process
GO:0006898	receptor-mediated endocytosis	IMP	biological process
GO:0150093	amyloid-beta clearance by transcytosis	ISS	biological process
GO:1905167	positive regulation of lysosomal protein catabolic process	IMP	biological process
GO:0045056	transcytosis	TAS	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	IGI	biological process
GO:0150094	amyloid-beta clearance by cellular catabolic process	ISS	biological process
GO:0150094	amyloid-beta clearance by cellular catabolic process	IMP	biological process
GO:0150094	amyloid-beta clearance by cellular catabolic process	IMP	biological process
GO:1900223	positive regulation of amyloid-beta clearance	TAS	biological process
GO:1900223	positive regulation of amyloid-beta clearance	ISS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	ISS	biological process
GO:0150104	transport across blood-brain barrier	ISS	biological process
GO:0002265	astrocyte activation involved in immune response	ISS	biological process
GO:0045807	positive regulation of endocytosis	IGI	biological process
GO:0016020	membrane	NAS	cellular component
GO:0098797	plasma membrane protein complex	TAS	cellular component
GO:0010942	positive regulation of cell death	IGI	biological process
GO:0032092	positive regulation of protein binding	IGI	biological process
GO:0031623	receptor internalization	TAS	biological process
GO:0097242	amyloid-beta clearance	NAS	biological process
GO:0010715	regulation of extracellular matrix disassembly	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0038024	cargo receptor activity	NAS	molecular function
GO:0016964	alpha-2 macroglobulin receptor activity	IMP	molecular function
GO:0007041	lysosomal transport	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0043235	receptor complex	IDA	cellular component
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904209	positive regulation of chemokine (C-X-C motif) ligand 2 production	IEA	biological process
GO:1904109	positive regulation of cholesterol import	IEA	biological process
GO:1900149	positive regulation of Schwann cell migration	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0061642	chemoattraction of axon	IEA	biological process
GO:0051481	negative regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0050766	positive regulation of phagocytosis	IEA	biological process
GO:0048694	positive regulation of collateral sprouting of injured axon	IEA	biological process
GO:0048691	positive regulation of axon extension involved in regeneration	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0030136	clathrin-coated vesicle	IEA	cellular component
GO:0021987	cerebral cortex development	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0010812	negative regulation of cell-substrate adhesion	IEA	biological process
GO:0008283	cell population proliferation	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:1904754	positive regulation of vascular associated smooth muscle cell migration	IEA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0051895	negative regulation of focal adhesion assembly	IEA	biological process
GO:0051222	positive regulation of protein transport	IEA	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0045177	apical part of cell	IEA	cellular component
GO:0044295	axonal growth cone	IEA	cellular component
GO:0044242	cellular lipid catabolic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0042157	lipoprotein metabolic process	IEA	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0032593	insulin-responsive compartment	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0007568	aging	IEA	biological process
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0070325	lipoprotein particle receptor binding	IC	molecular function
GO:0034185	apolipoprotein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010875	positive regulation of cholesterol efflux	ISS	biological process
GO:0014912	negative regulation of smooth muscle cell migration	ISS	biological process
GO:0032370	positive regulation of lipid transport	ISS	biological process
GO:0032374	regulation of cholesterol transport	ISS	biological process
GO:0032429	regulation of phospholipase A2 activity	ISS	biological process
GO:0030178	negative regulation of Wnt signaling pathway	ISS	biological process
GO:0032956	regulation of actin cytoskeleton organization	ISS	biological process
GO:0035909	aorta morphogenesis	ISS	biological process
GO:0043277	apoptotic cell clearance	ISS	biological process
GO:0097242	amyloid-beta clearance	TAS	biological process
GO:2000587	negative regulation of platelet-derived growth factor receptor-beta signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0150051	postsynaptic Golgi apparatus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0034185	apolipoprotein binding	IDA	molecular function
GO:0005509	calcium ion binding	ISS	molecular function
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0042953	lipoprotein transport	NAS	biological process
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04979	Cholesterol metabolism
hsa05144	Malaria

Diseases

Associated diseases	References
Alzheimer's disease	PMID:9635959
Sciatic neuropathy	PMID:18060043
Myocardial infarction	PMID:12402342
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R