• Gene id: 4025

Gene Summary

• Gene Symbol: LPO   Gene   UCSC   Ensembl
• Aliases: SPO
• Gene name: lactoperoxidase
• Alternate names: lactoperoxidase, salivary peroxidase,
• Gene location: 17q22 (161165823: 161178276)     Exons: 18     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the peroxidase family of proteins. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Following its secretion from salivary, mammary, and other mucosal glands, this enzyme catalyzes the gene
• OMIM: 150205

Protein Summary

• Protein general information: P22079  
  • Name: Lactoperoxidase (LPO) (EC 1.11.1.7) (Salivary peroxidase) (SPO)
  • Length: 712  
  • Mass: 80,288
• Sequence:

  MRVLLHLPALLASLILLQAAASTTRAQTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAMSSETPTSRQLSEYLK
  HAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLEVGCGAPAPVVRCDPCSPYRTITGDCNNRRK
  PALGAANRALARWLPAEYEDGLSLPFGWTPGKTRNGFPLPLAREVSNKIVGYLNEEGVLDQNRSLLFMQWGQIVD
  HDLDFAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAREQINAL
  TSFLDASFVYSSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKKPSPCEFINTTARVPCFLAGDSRASE
  HILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAFVQIITFRDYLPILLGDHMQKWIPPYQGYSE
  SVDPRISNVFTFAFRFGHLEVPSSMFRLDENYQPWGPEPELPLHTLFFNTWRMVKDGGIDPLVRGLLAKKSKLMK
  QNKMMTGELRNKLFQPTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGL
  YGTPDNIDIWIGAIAEPLVERGRVGPLLACLLGKQFQQIRDGDRFWWENPGVFTNEQKDSLQKMSFSRLVCDNTR
  ITKVPRDPFWANSYPYDFVDCSAIDKLDLSPWASVKN

• Structural information:
  • Interpro: IPR010255  IPR019791  IPR037120  IPR029587  
  • Prosite: PS50292
  • STRING: ENSP00000262290
• Other Databases: GeneCards:  LPO  Malacards:  LPO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006979	response to oxidative stress	NAS	biological process
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0018969	thiocyanate metabolic process	IEA	biological process
GO:0020037	heme binding	IEA	molecular function
GO:0036393	thiocyanate peroxidase activity	IDA	molecular function
GO:0042742	defense response to bacterium	IDA	biological process
GO:0042744	hydrogen peroxide catabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0004601	peroxidase activity	IEA	molecular function
GO:0004601	peroxidase activity	IEA	molecular function
GO:0004601	peroxidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006979	response to oxidative stress	IEA	biological process
GO:0006979	response to oxidative stress	NAS	biological process
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0018969	thiocyanate metabolic process	IEA	biological process
GO:0020037	heme binding	IEA	molecular function
GO:0036393	thiocyanate peroxidase activity	IEA	molecular function
GO:0036393	thiocyanate peroxidase activity	IDA	molecular function
GO:0042742	defense response to bacterium	IEA	biological process
GO:0042742	defense response to bacterium	IDA	biological process
GO:0042744	hydrogen peroxide catabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0006979	response to oxidative stress	NAS	biological process
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0036393	thiocyanate peroxidase activity	IDA	molecular function
GO:0042742	defense response to bacterium	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04970	Salivary secretion

Diseases

Associated diseases	References
Cancer	GAD: 19505917
Cancer (brain)	GAD: 19505917
Cancer (meningeal)	GAD: 20406964
Female infertility	INFBASE: 11523228
Endometriosis	INFBASE: 11523228
Male factor infertility	MIK: 24082556
Chronic renal failure	GAD: 21085059
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 24082556
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24082556	Male infertility		Northea st Indi a	70 (50 infertile individuals, 20 fertile donors)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881