• Gene id: 402117

Gene Summary

• Gene Symbol: VWC2L   Gene   UCSC   Ensembl
• Gene name: von Willebrand factor C domain containing 2 like
• Alternate names: von Willebrand factor C domain-containing protein 2-like, brorin-like, von Willebrand factor C domain containing protein 2 like,
• Gene location: 2q34-q35 (214411053: 214578975)     Exons: 5     NC_000002.12
• OMIM: 606511

Protein Summary

• Protein general information: B2RUY7  
  • Name: von Willebrand factor C domain containing protein 2 like (Brorin like)
  • Length: 222  
  • Mass: 24570
• Sequence:

  MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCP
  CVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHGKNYKILEEFKPSPCEWCRCEPSNEVHCVVA
  DCAVPECVNPVYEPEQCCPVCKNGPNCFAGTTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTV

• Structural information:
  • Protein Domains: (51..11-)
    (/note="VWFC-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00220-)
    (114..17-)
    (/note="VWFC-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00220"-)
  • Interpro: IPR042979  IPR001007  
  • Prosite: PS01208 PS50184
  • STRING: ENSP00000308976
• Other Databases: GeneCards:  VWC2L  Malacards:  VWC2L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0032281	AMPA glutamate receptor complex	IBA	cellular component
GO:0030514	negative regulation of BMP signaling pathway	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0032281	AMPA glutamate receptor complex	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq