• Gene id: 402

Gene Summary

• Gene Symbol: ARL2   Gene   UCSC   Ensembl
• Aliases: ARFL2
• Gene name: ADP ribosylation factor like GTPase 2
• Alternate names: ADP-ribosylation factor-like protein 2, ADP-ribosylation factor-like 2,
• Gene location: 11q13.1 (165469679: 165689406)     Exons: 11     NC_000002.12
• Gene summary(Entrez): This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ribosylation factor (ARF). The encoded protein is one of a functionally distinct group of ARF-like genes. [provided by RefSeq, Jul 2008]
• OMIM: 601175

SNPs

rs140132974

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000009.12   g.135697628C>T
NC_000009.11   g.138589474C>T
NG_033070.1   g.444C>T
NG_033784.1   g.6901G>A|SEQ=[C/T]|GENE=SOHLH1

Protein Summary

• Protein general information: P36404  
  • Name: ADP ribosylation factor like protein 2
  • Length: 184  
  • Mass: 20878
• Sequence:

  MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRS
  YWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSH
  HWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR006689  
  • Prosite: PS51417
  • PDB: 3DOE 3DOF
  • PDBsum: 3DOE 3DOF
  • DIP: 47535
  • STRING: ENSP00000246747
• Other Databases: GeneCards:  ARL2  Malacards:  ARL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005525	GTP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005095	GTPase inhibitor activity	TAS	molecular function
GO:0007021	tubulin complex assembly	TAS	biological process
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0050796	regulation of insulin secretion	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0019003	GDP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005929	cilium	IDA	NOT|cellular component
GO:0031116	positive regulation of microtubule polymerization	IBA	biological process
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0005525	GTP binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0051457	maintenance of protein location in nucleus	IDA	biological process
GO:0034260	negative regulation of GTPase activity	IDA	biological process
GO:0031116	positive regulation of microtubule polymerization	IDA	biological process
GO:0031116	positive regulation of microtubule polymerization	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0005758	mitochondrial intermembrane space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016328	lateral plasma membrane	ISS	cellular component
GO:0010811	positive regulation of cell-substrate adhesion	ISS	biological process
GO:0005525	GTP binding	IMP	molecular function
GO:0003924	GTPase activity	IMP	molecular function
GO:0070830	bicellular tight junction assembly	ISS	biological process
GO:0007098	centrosome cycle	IMP	biological process
GO:0031113	regulation of microtubule polymerization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray