• Gene id: 4017

Gene Summary

• Gene Symbol: LOXL2   Gene   UCSC   Ensembl
• Aliases: LOR, LOR2, WS9-14
• Gene name: lysyl oxidase like 2
• Alternate names: lysyl oxidase homolog 2, lysyl oxidase related 2, lysyl oxidase-like 2 delta e13, lysyl oxidase-like 2 protein, lysyl oxidase-like protein 2, lysyl oxidase-related protein 2, lysyl oxidase-related protein WS9-14,
• Gene location: 8p21.3 (100436614: 100435281)     Exons: 5     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation o
• OMIM: 606663

Protein Summary

• Protein general information: Q9Y4K0  
  • Name: Lysyl oxidase homolog 2 (EC 1.4.3.13) (Lysyl oxidase like protein 2) (Lysyl oxidase related protein 2) (Lysyl oxidase related protein WS9 14)
  • Length: 774  
  • Mass: 86725
  • Tissue specificity: Expressed in many tissues (PubMed
• Sequence:

  MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRLAGQKRKHSEGRVEVY
  YDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGPIWLDNLHCTGNEATLAACTSNGWGVTDCKH
  TEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQICDKHWTAK
  NSRVVCGMFGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVS
  CVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSASVVCRELGFGSAKEA
  VTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDAGVRCNTPAMGLQKKLRLNGGRNPYEGRVEV
  LVERNGSLVWGMVCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDG
  EDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFS
  SQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECAN
  FGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGG
  SFSEETEKKFEHFSGLLNNQLSPQ

• Structural information:
  • Protein Domains: (58..15-)
    (/note="SRCR-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (188..30-)
    (/note="SRCR-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (326..42-)
    (/note="SRCR-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (-)
  • Interpro: IPR001695  IPR019828  IPR001190  IPR017448  IPR036772  
  • Prosite: PS00926 PS00420 PS50287
  • PDB: 5ZE3
  • PDBsum: 5ZE3
  • STRING: ENSP00000373783
• Other Databases: GeneCards:  LOXL2  Malacards:  LOXL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0018057	peptidyl-lysine oxidation	IBA	biological process
GO:0004720	protein-lysine 6-oxidase activity	IBA	molecular function
GO:0030199	collagen fibril organization	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0006464	cellular protein modification process	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0070492	oligosaccharide binding	IDA	molecular function
GO:0046688	response to copper ion	IDA	biological process
GO:0004720	protein-lysine 6-oxidase activity	IDA	molecular function
GO:0001837	epithelial to mesenchymal transition	IDA	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005507	copper ion binding	IDA	molecular function
GO:0018057	peptidyl-lysine oxidation	IDA	biological process
GO:0004720	protein-lysine 6-oxidase activity	IDA	molecular function
GO:0043542	endothelial cell migration	IMP	biological process
GO:0005604	basement membrane	ISS	cellular component
GO:0002040	sprouting angiogenesis	IMP	biological process
GO:0001666	response to hypoxia	ISS	biological process
GO:0032332	positive regulation of chondrocyte differentiation	ISS	biological process
GO:0030199	collagen fibril organization	IMP	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0001935	endothelial cell proliferation	IMP	biological process
GO:0005507	copper ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016641	oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005604	basement membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0006464	cellular protein modification process	TAS	biological process
GO:0007568	aging	TAS	biological process
GO:0004720	protein-lysine 6-oxidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001666	response to hypoxia	IEA	biological process
GO:1902455	negative regulation of stem cell population maintenance	IEA	biological process
GO:0032332	positive regulation of chondrocyte differentiation	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005604	basement membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0022900	electron transport chain	IEA	biological process
GO:0000785	chromatin	IDA	cellular component
GO:0018057	peptidyl-lysine oxidation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0018057	peptidyl-lysine oxidation	IDA	biological process
GO:0004720	protein-lysine 6-oxidase activity	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0004720	protein-lysine 6-oxidase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0009055	electron transfer activity	TAS	molecular function
GO:1902455	negative regulation of stem cell population maintenance	ISS	biological process
GO:0010718	positive regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0070828	heterochromatin organization	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq