• Gene id: 401505

Gene Summary

• Gene Symbol: TOMM5   Gene   UCSC   Ensembl
• Aliases: C9orf105, Tom5, bA613M10.3
• Gene name: translocase of outer mitochondrial membrane 5
• Alternate names: mitochondrial import receptor subunit TOM5 homolog, mitochondrial outer membrane protein TOM5, translocase of outer mitochondrial membrane 5 homolog,
• Gene location: 9p13.2 (37592638: 37588412)     Exons: 34     NC_000009.12
• OMIM: 616169

Protein Summary

• Protein general information: Q8N4H5  
  • Name: Mitochondrial import receptor subunit TOM5 homolog
  • Length: 51  
  • Mass: 6035
• Sequence:

  MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI

• Structural information:
  • Interpro: IPR019603  IPR029179  
  • STRING: ENSP00000438204
• Other Databases: GeneCards:  TOMM5  Malacards:  TOMM5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005742	mitochondrial outer membrane translocase complex	IBA	cellular component
GO:0005742	mitochondrial outer membrane translocase complex	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005742	mitochondrial outer membrane translocase complex	IDA	cellular component
GO:0006626	protein targeting to mitochondrion	IC	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)