• Gene id: 4015

Gene Summary

• Gene Symbol: LOX   Gene   UCSC   Ensembl
• Aliases: AAT10
• Gene name: lysyl oxidase
• Alternate names: protein-lysine 6-oxidase,
• Gene location: 5q23.1 (122078258: 122063194)     Exons: 13     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the m
• OMIM: 153455

Protein Summary

• Protein general information: P28300  
  • Name: Protein lysine 6 oxidase (EC 1.4.3.13) (Lysyl oxidase) [Cleaved into: Protein lysine 6 oxidase, long form; Protein lysine 6 oxidase, short form]
  • Length: 417  
  • Mass: 46944
  • Tissue specificity: Heart, placenta, skeletal muscle, kidney, lung and pancreas. {ECO
• Sequence:

  MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSLGSQYQPQRRRDPGAA
  VPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPTARHWFQAGYSTSRAREAGASRAENQTAPGE
  VPALSNLRPPSRVDGMVGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQAS
  TYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDE
  FSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYI
  LKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

• Structural information:
  • Interpro: IPR001695  IPR019828  
  • Prosite: PS00926
  • DIP: 49007
  • STRING: ENSP00000231004
• Other Databases: GeneCards:  LOX  Malacards:  LOX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018057	peptidyl-lysine oxidation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004720	protein-lysine 6-oxidase activity	IBA	molecular function
GO:0005576	extracellular region	ISS	cellular component
GO:0048514	blood vessel morphogenesis	ISS	biological process
GO:0004720	protein-lysine 6-oxidase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005507	copper ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016641	oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004720	protein-lysine 6-oxidase activity	TAS	molecular function
GO:0005507	copper ion binding	TAS	molecular function
GO:0006464	cellular protein modification process	TAS	biological process
GO:0004720	protein-lysine 6-oxidase activity	IEA	molecular function
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060326	cell chemotaxis	IEA	biological process
GO:0048251	elastic fiber assembly	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0035791	platelet-derived growth factor receptor-beta signaling pathway	IEA	biological process
GO:0030199	collagen fibril organization	IEA	biological process
GO:0018158	protein oxidation	IEA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004720	protein-lysine 6-oxidase activity	IEA	molecular function
GO:2000586	regulation of platelet-derived growth factor receptor-beta signaling pathway	IEA	biological process
GO:1990869	cellular response to chemokine	IEA	biological process
GO:1903010	regulation of bone development	IEA	biological process
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0061448	connective tissue development	IEA	biological process
GO:0060326	cell chemotaxis	IEA	biological process
GO:0048747	muscle fiber development	IEA	biological process
GO:0048251	elastic fiber assembly	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0035906	descending aorta development	IEA	biological process
GO:0035905	ascending aorta development	IEA	biological process
GO:0035904	aorta development	IEA	biological process
GO:0035791	platelet-derived growth factor receptor-beta signaling pathway	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0030282	bone mineralization	IEA	biological process
GO:0030199	collagen fibril organization	IEA	biological process
GO:0016202	regulation of striated muscle tissue development	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0005581	collagen trimer	IEA	cellular component
GO:0004720	protein-lysine 6-oxidase activity	IEA	molecular function
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0001568	blood vessel development	IEA	biological process
GO:1900120	regulation of receptor binding	IEA	biological process
GO:0048545	response to steroid hormone	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0005507	copper ion binding	IEA	molecular function
GO:1900120	regulation of receptor binding	IEA	biological process
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0046716	muscle cell cellular homeostasis	IEA	biological process
GO:0045652	regulation of megakaryocyte differentiation	IEA	biological process
GO:0043491	protein kinase B signaling	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0017015	regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001649	osteoblast differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0018057	peptidyl-lysine oxidation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005518	collagen binding	IDA	molecular function
GO:0004720	protein-lysine 6-oxidase activity	IDA	molecular function

Diseases

Associated diseases	References
Familial thoracic aortic aneurysm and dissection	KEGG:H00801
Familial thoracic aortic aneurysm and dissection	KEGG:H00801
Hypertension	PMID:8562290
Ehlers-Danlos syndrome	PMID:8638917
Menkes disease	PMID:8638917
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray