• Gene id: 4012

Gene Summary

• Gene Symbol: LNPEP   Gene   UCSC   Ensembl
• Aliases: CAP, IRAP, P-LAP, PLAP
• Gene name: leucyl and cystinyl aminopeptidase
• Alternate names: leucyl-cystinyl aminopeptidase, AT (4) receptor, angiotensin IV receptor, cystinyl aminopeptidase, insulin-regulated aminopeptidase, insulin-regulated membrane aminopeptidase, insulin-responsive aminopeptidase, otase, oxytocinase, placental leucine aminopeptidase, ,
• Gene location: 5q15 (96934858: 97037512)     Exons: 20     NC_000005.10
• Gene summary(Entrez): This gene encodes a zinc-dependent aminopeptidase that cleaves vasopressin, oxytocin, lys-bradykinin, met-enkephalin, dynorphin A and other peptide hormones. The protein can be secreted in maternal serum, reside in intracellular vesicles with the insulin-
• OMIM: 151300

Protein Summary

• Protein general information: Q9UIQ6  
  • Name: Leucyl cystinyl aminopeptidase (Cystinyl aminopeptidase) (EC 3.4.11.3) (Insulin regulated membrane aminopeptidase) (Insulin responsive aminopeptidase) (IRAP) (Oxytocinase) (OTase) (Placental leucine aminopeptidase) (P LAP) [Cleaved into: Leucyl cystinyl a
  • Length: 1025  
  • Mass: 117349
  • Tissue specificity: Highly expressed in placenta, heart, kidney and small intestine. Detected at lower levels in neuronal cells in the brain, in skeletal muscle, spleen, liver, testes and colon. {ECO
• Sequence:

  MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGEHEMEEDEEDYESSAK
  LLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVVAVSVIMVIYLLPRCTFTKEGCHKKNQSIGL
  IQPFATNGKLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAV
  SSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAAR
  SAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNG
  TLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTS
  SMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLN
  SSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQT
  LDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMKPEIQPSDTSYLWHIPLSYVTEGRNYSKYQSVSLLD
  KKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAF
  DLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLE
  FACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASS
  EDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFS
  TKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL

• Structural information:
  • Interpro: IPR042097  IPR034017  IPR024571  IPR034016  IPR001930   IPR014782  
  • Prosite: PS00142
  • CDD: cd09601
  • PDB: 4P8Q 4PJ6 4Z7I 5C97 5JHQ 5MJ6
  • PDBsum: 4P8Q 4PJ6 4Z7I 5C97 5JHQ 5MJ6
  • STRING: ENSP00000231368
• Other Databases: GeneCards:  LNPEP  Malacards:  LNPEP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	ISS	cellular component
GO:0004177	aminopeptidase activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0006508	proteolysis	IBA	biological process
GO:0008270	zinc ion binding	IBA	molecular function
GO:0070006	metalloaminopeptidase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0042277	peptide binding	IBA	molecular function
GO:0043171	peptide catabolic process	IBA	biological process
GO:0004177	aminopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0004177	aminopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	TAS	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0006508	proteolysis	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007565	female pregnancy	TAS	biological process
GO:0004177	aminopeptidase activity	EXP	molecular function
GO:0004177	aminopeptidase activity	EXP	molecular function
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0002480	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0031905	early endosome lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060395	SMAD protein signal transduction	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0004177	aminopeptidase activity	IEA	molecular function
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0030163	protein catabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04614	Renin-angiotensin system

Diseases

Associated diseases	References
leiomyoma	PMID:7446622
Breast cancer	PMID:10508127
renal cell carcinoma	PMID:17692401
Polyhydramnios	PMID:1789335
type 2 diabetes mellitus	PMID:11701721
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)