• Gene id: 401152

Gene Summary

• Gene Symbol: C4orf3   Gene   UCSC   Ensembl
• Aliases: ALN, HCVFTP1
• Gene name: chromosome 4 open reading frame 3
• Alternate names: uncharacterized protein C4orf3, HCV F-transactivated protein 1, another-regulin, hepatitis C virus F protein-transactivated protein 1,
• Gene location: 4q26 (119304444: 119296418)     Exons: 3     NC_000004.12
• OMIM: 0

Protein Summary

• Protein general information: Q8WVX3  
  • Name: Uncharacterized protein C4orf3 (Hepatitis C virus F protein transactivated protein 1) (HCV F transactivated protein 1)
  • Length: 66  
  • Mass: 7604
• Sequence:

  MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSYWLDLWLFILFDVVVFLFVYFLP

• Structural information:
  • Interpro: IPR038780  
  • STRING: ENSP00000382026
• Other Databases: GeneCards:  C4orf3  Malacards:  C4orf3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901895	negative regulation of ATPase-coupled calcium transmembrane transporter activity	IBA	biological process
GO:1901877	negative regulation of calcium ion binding	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)