• Gene id: 400830

Gene Summary

• Gene Symbol: DEFB132   Gene   UCSC   Ensembl
• Aliases: BD-32, DEFB-32, DEFB32, HEL-75, KFLL827, UNQ827
• Gene name: defensin beta 132
• Alternate names: beta-defensin 132, RP5-1103G7.6, beta-defensin 32, defensin HEL-75, defensin, beta 32,
• Gene location: 20p13 (257723: 261095)     Exons: 2     NC_000020.11
• Gene summary(Entrez): Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The protein encoded by this gene is secreted and is a member of the beta defensin protein family. This protein binds spermatozoa a
• OMIM: 0

Protein Summary

• Protein general information: Q7Z7B7  
  • Name: Beta defensin 132 (Beta defensin 32) (BD 32) (DEFB 32) (Defensin HEL 75) (Defensin, beta 132)
  • Length: 95  
  • Mass: 10610
• Sequence:

  MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHW
  QSRRRNTQRKDKKQQTTVTS

• Structural information:
  • Interpro: IPR025933  
  • STRING: ENSP00000371813
• Other Databases: GeneCards:  DEFB132  Malacards:  DEFB132

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0061827	sperm head	IDA	cellular component
GO:0050829	defense response to Gram-negative bacterium	IC	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0031640	killing of cells of other organism	IDA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)