• Gene id: 400746

Gene Summary

• Gene Symbol: NCMAP   Gene   UCSC   Ensembl
• Aliases: C1orf130, MP11
• Gene name: non-compact myelin associated protein
• Alternate names: noncompact myelin-associated protein, myelin protein of 11 kDa,
• Gene location: 1p36.11 (24556086: 24609327)     Exons: 6     NC_000001.11

Protein Summary

• Protein general information: Q5T1S8  
  • Name: Noncompact myelin associated protein (Myelin protein of 11 kDa) (MP11)
  • Length: 102  
  • Mass: 11082
• Sequence:

  MTTATPLGDTTFFSLNMTTRGEDFLYKSSGAIVAAVVVVVIIIFTVVLILLKMYNRKMRTRRELEPKGPKPTAPS
  AVGPNSNGSQHPATVTFSPVDVQVETR

• Structural information:
  • Interpro: IPR038940  
  • STRING: ENSP00000363513
• Other Databases: GeneCards:  NCMAP  Malacards:  NCMAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033270	paranode region of axon	IBA	cellular component
GO:0043220	Schmidt-Lanterman incisure	IBA	cellular component
GO:0019911	structural constituent of myelin sheath	IBA	molecular function
GO:0032290	peripheral nervous system myelin formation	IBA	biological process
GO:0032290	peripheral nervous system myelin formation	ISS	biological process
GO:0031643	positive regulation of myelination	ISS	biological process
GO:0019911	structural constituent of myelin sheath	ISS	molecular function
GO:0043220	Schmidt-Lanterman incisure	ISS	cellular component
GO:0033270	paranode region of axon	ISS	cellular component
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0019911	structural constituent of myelin sheath	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0031641	regulation of myelination	IEA	biological process
GO:0033270	paranode region of axon	IEA	cellular component
GO:0043220	Schmidt-Lanterman incisure	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq