• Gene id: 4007

Gene Summary

• Gene Symbol: PRICKLE3   Gene   UCSC   Ensembl
• Aliases: LMO6, Pk3
• Gene name: prickle planar cell polarity protein 3
• Alternate names: prickle planar cell polarity protein 3, LIM domain only protein 6, LMO-6, prickle homolog 3, prickle-like protein 3, triple LIM domain protein 6,
• Gene location: Xp11.23 (49186372: 49174801)     Exons: 10     NC_000023.11
• Gene summary(Entrez): LIM domain only 6 is a three LIM domain-containing protein. The LIM domain is a cysteine-rich sequence motif that binds zinc atoms to form a specific protein-binding interface for protein-protein interactions. [provided by RefSeq, Jul 2008]
• OMIM: 616478

Protein Summary

• Protein general information: O43900  
  • Name: Prickle planar cell polarity protein 3 (LIM domain only protein 6) (LMO 6) (Prickle like protein 3) (Pk3) (Triple LIM domain protein 6)
  • Length: 615  
  • Mass: 68609
  • Tissue specificity: Widely expressed.
• Sequence:

  MFARGSRRRRSGRAPPEAEDPDRGQPCNSCREQCPGFLLHGWRKICQHCKCPREEHAVHAVPVDLERIMCRLISD
  FQRHSISDDDSGCASEEYAWVPPGLKPEQVYQFFSCLPEDKVPYVNSPGEKYRIKQLLHQLPPHDSEAQYCTALE
  EEEKKELRAFSQQRKRENLGRGIVRIFPVTITGAICEECGKQIGGGDIAVFASRAGLGACWHPQCFVCTTCQELL
  VDLIYFYHVGKVYCGRHHAECLRPRCQACDEIIFSPECTEAEGRHWHMDHFCCFECEASLGGQRYVMRQSRPHCC
  ACYEARHAEYCDGCGEHIGLDQGQMAYEGQHWHASDRCFCCSRCGRALLGRPFLPRRGLIFCSRACSLGSEPTAP
  GPSRRSWSAGPVTAPLAASTASFSAVKGASETTTKGTSTELAPATGPEEPSRFLRGAPHRHSMPELGLRSVPEPP
  PESPGQPNLRPDDSAFGRQSTPRVSFRDPLVSEGGPRRTLSAPPAQRRRPRSPPPRAPSRRRHHHHNHHHHHNRH
  PSRRRHYQCDAGSGSDSESCSSSPSSSSSESSEDDGFFLGERIPLPPHLCRPMPAQDTAMETFNSPSLSLPRDSR
  AGMPRQARDKNCIVA

• Structural information:
  • Protein Domains: (74..18-)
    (/note="PET-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00636-)
    (184..24-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (250..30-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-)
  • Interpro: IPR033725  IPR033726  IPR033727  IPR010442  IPR033723   IPR001781  
  • Prosite: PS00478 PS50023 PS51303
  • CDD: cd09415 cd09418 cd09420 cd09827
  • STRING: ENSP00000470248
• Other Databases: GeneCards:  PRICKLE3  Malacards:  PRICKLE3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0030030	cell projection organization	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881