• Gene id: 400629

Gene Summary

• Gene Symbol: TEX19   Gene   UCSC   Ensembl
• Gene name: testis expressed 19
• Alternate names: testis-expressed protein 19, testis-expressed sequence 19 protein,
• Gene location: 17q25.3 (82359246: 82363775)     Exons: 3     NC_000017.11
• OMIM: 603880

Protein Summary

• Protein general information: Q8NA77  
  • Name: Testis expressed protein 19
  • Length: 164  
  • Mass: 18469
  • Tissue specificity: Expressed in testis. Expressed in undifferentiated embryonic stem cells. {ECO
• Sequence:

  MCPPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESEDWEEDNWDPELMEHTEAESEQEG
  SSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFE
  ELLTCSHWPSFFPS

• Structural information:
  • Interpro: IPR029093  
  • STRING: ENSP00000331500
• Other Databases: GeneCards:  TEX19  Malacards:  TEX19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008584	male gonad development	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0010529	negative regulation of transposition	IBA	biological process
GO:0007283	spermatogenesis	IBA	biological process
GO:0001890	placenta development	IBA	biological process
GO:0010529	negative regulation of transposition	IDA	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007140	male meiotic nuclear division	ISS	biological process
GO:0034584	piRNA binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007131	reciprocal meiotic recombination	ISS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881