• Gene id: 400451

Gene Summary

• Gene Symbol: FAM174B   Gene   UCSC   Ensembl
• Gene name: family with sequence similarity 174 member B
• Alternate names: membrane protein FAM174B,
• Gene location: 15q26.1 (92734218: 92617446)     Exons: 6     NC_000015.10
• OMIM: 606886

Protein Summary

• Protein general information: Q3ZCQ3  
  • Name: Membrane protein FAM174B
  • Length: 159  
  • Mass: 16967
• Sequence:

  MRAVPLPAPLLPLLLLALLAAPAARASRAESVSAPWPEPERESRPPPGPGPGNTTRFGSGAAGGSGSSSSNSSGD
  ALVTRISILLRDLPTLKAAVIVAFAFTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDED
  STVFDIKYR

• Structural information:
  • Interpro: IPR009565  
  • STRING: ENSP00000329040
• Other Databases: GeneCards:  FAM174B  Malacards:  FAM174B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0007030	Golgi organization	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0007030	Golgi organization	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881