• Gene id: 399948

Gene Summary

• Gene Symbol: COLCA1   Gene   UCSC   Ensembl
• Aliases: C11orf92, CASC12, LOH11CR1F
• Gene name: colorectal cancer associated 1
• Alternate names: colorectal cancer-associated protein 1, cancer susceptibility candidate 12,
• Gene location: 11q23.1 (111305047: 111293388)     Exons: 6     NC_000011.10
• Gene summary(Entrez): This gene encodes a transmembrane protein that localizes to granular structures, including crystalloid eosinophilic granules and other granular organelles. This gene, along with an overlapping opposite strand gene, has been implicated as a susceptibility

Protein Summary

• Protein general information: Q6ZS62  
  • Name: Colorectal cancer associated protein 1
  • Length: 124  
  • Mass: 13401
  • Tissue specificity: Expressed in gastrointestinal and immune tissue, as well as prostate, testis and ovary. Expressed in lamina propria and eosinophils but not in epithelial cells. Expression is greater in benign adjacent tissues than in colon tumors. {EC
• Sequence:

  MESCSVAQAGVLTSPFMWRWTGMAGALSALDNTIEDDADDQLPCGEGRPGWVRGELLGSQGVCKDSKDLFVPTSS
  SLYGCFCVGLVSGMAISVLLLASDFRKLDFSRPEPCFEKEASLWFVAQH

• Other Databases: GeneCards:  COLCA1  Malacards:  COLCA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray