• Gene id: 3998

Gene Summary

• Gene Symbol: LMAN1   Gene   UCSC   Ensembl
• Aliases: ERGIC-53, ERGIC53, F5F8D, FMFD1, MCFD1, MR60, gp58
• Gene name: lectin, mannose binding 1
• Alternate names: protein ERGIC-53, ER-Golgi intermediate compartment 53 kDa protein, endoplasmic reticulum-golgi intermediate compartment protein 53, intracellular mannose-specific lectin MR60,
• Gene location: 18q21.32 (59359264: 59327822)     Exons: 13     NC_000018.10
• Gene summary(Entrez): The protein encoded by this gene is a membrane mannose-specific lectin that cycles between the endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment, and cis-Golgi, functioning as a cargo receptor for glycoprotein transport. The prot
• OMIM: 601567

Protein Summary

• Protein general information: P49257  
  • Name: Protein ERGIC 53 (ER Golgi intermediate compartment 53 kDa protein) (Gp58) (Intracellular mannose specific lectin MR60) (Lectin mannose binding 1)
  • Length: 510  
  • Mass: 57549
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIP
  SSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIF
  FDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKN
  DYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQEL
  DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGA
  GMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDI
  DNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF

• Structural information:
  • Protein Domains: (44..26-)
    (/note="L-type-lectin-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00658"-)
  • Interpro: IPR013320  IPR005052  IPR033085  
  • Prosite: PS51328
  • PDB: 3A4U 3LCP 3WHT 3WHU 3WNX 4GKX 4GKY 4YGB 4YGC 4YGD 4YGE
  • PDBsum: 3A4U 3LCP 3WHT 3WHU 3WNX 4GKX 4GKY 4YGB 4YGC 4YGD 4YGE
  • DIP: 42188
  • STRING: ENSP00000251047
• Other Databases: GeneCards:  LMAN1  Malacards:  LMAN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903215	negative regulation of protein targeting to mitochondrion	HMP	biological process
GO:0000139	Golgi membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005537	mannose binding	IBA	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0007029	endoplasmic reticulum organization	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0030134	COPII-coated ER to Golgi transport vesicle	IBA	cellular component
GO:0034498	early endosome to Golgi transport	IMP	NOT|biological process
GO:0010638	positive regulation of organelle organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032527	protein exit from endoplasmic reticulum	IMP	NOT|biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005537	mannose binding	IEA	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005537	mannose binding	TAS	molecular function
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0018279	protein N-linked glycosylation via asparagine	TAS	biological process
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	IEA	cellular component
GO:0030017	sarcomere	IEA	cellular component
GO:0007029	endoplasmic reticulum organization	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0044220	host cell perinuclear region of cytoplasm	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Combined deficiency of factors V and VIII	KEGG:H00221
Combined deficiency of factors V and VIII	KEGG:H00221
Factor XIII deficiency	PMID:9546392
Factor V deficiency	PMID:9546392
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881