• Gene id: 399694

Gene Summary

• Gene Symbol: SHC4   Gene   UCSC   Ensembl
• Aliases: RaLP, SHCD
• Gene name: SHC adaptor protein 4
• Alternate names: SHC-transforming protein 4, SH2 domain protein C4, SHC (Src homology 2 domain containing) family, member 4, SHC-transforming protein D, hShcD, rai-like protein, src homology 2 domain-containing-transforming protein C4,
• Gene location: 15q21.1 (48963918: 48823740)     Exons: 13     NC_000015.10
• OMIM: 617372

Protein Summary

• Protein general information: Q6S5L8  
  • Name: SHC transforming protein 4 (Rai like protein) (RaLP) (SHC transforming protein D) (hShcD) (Src homology 2 domain containing transforming protein C4) (SH2 domain protein C4)
  • Length: 630  
  • Mass: 68785
  • Tissue specificity: Only expressed in melanomas. Weakly expressed in normal melanocytes and benign nevi. Highly expressed at the transition from radial growth phase to vertical growth phase and metastatic melanomas, when tumor cells acquire migratory comp
• Sequence:

  MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPHPALAPHLPTEDATLP
  SQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPPQQDL
  VGHRATALTPDSCPLPGPGEPTLRSRQDRHFLQHLLGMGMNYCVRYMGCVEVLQSMRSLDFGMRTQVTREAISRL
  CEAVPGANGAIKKRKPPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
  TDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEVHIDSHAEEREDHEYY
  NEIPGKQPPVGGVSDMRIKVQATEQMAYCPIQCEKLCYLPGNSKCSSVYENCLEQSRAIGNVHPRGVQSQRDTSL
  LKHTCRVDLFDDPCYINTQALQSTPGSAGNQRSAQPLGSPWHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEE
  CYHGKLSRKAAESLLVKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
  SLPIISSGSEVSLKQPVRKDNNPALLHSNK

• Structural information:
  • Protein Domains: (186..36-)
    (/note="PID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00148-)
    (526..61-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"-)
  • Interpro: IPR011993  IPR006019  IPR006020  IPR000980  IPR036860   IPR029596  IPR035676  
  • Prosite: PS01179 PS50001
  • CDD: cd01209 cd09925
  • STRING: ENSP00000329668
• Other Databases: GeneCards:  SHC4  Malacards:  SHC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030971	receptor tyrosine kinase binding	IBA	molecular function
GO:0019901	protein kinase binding	IBA	molecular function
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0048863	stem cell differentiation	IEA	biological process
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0048863	stem cell differentiation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0045211	postsynaptic membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer
hsa04014	Ras signaling pathway
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05034	Alcoholism
hsa05225	Hepatocellular carcinoma
hsa04072	Phospholipase D signaling pathway
hsa04910	Insulin signaling pathway
hsa05226	Gastric cancer
hsa05224	Breast cancer
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa04915	Estrogen signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa04012	ErbB signaling pathway
hsa01522	Endocrine resistance
hsa05100	Bacterial invasion of epithelial cells
hsa05220	Chronic myeloid leukemia
hsa05214	Glioma
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa04917	Prolactin signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881