Search Result
Gene id | 399512 | ||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||
Gene Symbol | SLC25A35 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||
Gene name | solute carrier family 25 member 35 | ||||||||||||||||||||||||||||||||
Alternate names | solute carrier family 25 member 35, | ||||||||||||||||||||||||||||||||
Gene location |
17p13.1 (8295688: 8287762) Exons: 9 NC_000017.11 |
||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).[supplied by OMIM, Mar 2008] |
||||||||||||||||||||||||||||||||
OMIM | 601017 | ||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||
Protein general information | Q3KQZ1 Name: Solute carrier family 25 member 35 Length: 300 Mass: 32438 | ||||||||||||||||||||||||||||||||
Sequence |
MDFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGLAALQKGLAPALLYQFL MNGIRLGTYGLAEAGGYLHTAEGTHSPARSAAAGAMAGVMGAYLGSPIYMVKTHLQAQAASEIAVGHQYKHQGMF QALTEIGQKHGLVGLWRGALGGLPRVIVGSSTQLCTFSSTKDLLSQWEIFPPQSWKLALVAAMMSGIAVVLAMAP FDVACTRLYNQPTDAQGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSLYYTDTK | ||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||
Other Databases | GeneCards: SLC25A35  Malacards: SLC25A35 | ||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||
|