• Gene id: 3990

Gene Summary

• Gene Symbol: LIPC   Gene   UCSC   Ensembl
• Aliases: HDLCQ12, HL, HTGL, LIPH
• Gene name: lipase C, hepatic type
• Alternate names: hepatic triacylglycerol lipase, Triacylglycerol lipase, hepatic lipase, lipase member C, lipase, hepatic,
• Gene location: 15q21.3 (58410456: 58569843)     Exons: 15     NC_000015.10
• Gene summary(Entrez): LIPC encodes hepatic triglyceride lipase, which is expressed in liver. LIPC has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. [provided by RefSeq, Jul 2008]
• OMIM: 151670

Protein Summary

• Protein general information: P11150  
  • Name: Hepatic triacylglycerol lipase (HL) (Hepatic lipase) (EC 3.1.1.3) (Lipase member C)
  • Length: 499  
  • Mass: 55914
• Sequence:

  MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKTRFLLFGETNQGCQIRINHPDTLQEC
  GFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLVGKEVAALLRW
  LEESVQLSRSHVHLIGYSLGAHVSGFAGSSIGGTHKIGRITGLDAAGPLFEGSAPSNRLSPDDANFVDAIHTFTR
  EHMGLSVGIKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAY
  PCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKVYHYQFKIQFINQTETPIQTTFTMS
  LLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKWENSAVWANVWDTVQTIIPWSTGPRHSGLVL
  KTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR

• Structural information:
  • Protein Domains: (352..48-)
    (/note="PLAT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00152"-)
  • Interpro: IPR029058  IPR013818  IPR002333  IPR016272  IPR033906   IPR001024  IPR036392  IPR000734  
  • Prosite: PS00120 PS50095
  • CDD: cd00707
  • STRING: ENSP00000299022
• Other Databases: GeneCards:  LIPC  Malacards:  LIPC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016042	lipid catabolic process	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0016298	lipase activity	IBA	molecular function
GO:0034185	apolipoprotein binding	IBA	molecular function
GO:0008970	phospholipase A1 activity	IDA	molecular function
GO:0008970	phospholipase A1 activity	IDA	molecular function
GO:0008970	phospholipase A1 activity	IDA	molecular function
GO:0004806	triglyceride lipase activity	IDA	molecular function
GO:0004806	triglyceride lipase activity	IDA	molecular function
GO:0004806	triglyceride lipase activity	IDA	molecular function
GO:0004806	triglyceride lipase activity	IDA	molecular function
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0034364	high-density lipoprotein particle	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008970	phospholipase A1 activity	IEA	molecular function
GO:0004622	lysophospholipase activity	IEA	molecular function
GO:0102545	phosphatidyl phospholipase B activity	IEA	molecular function
GO:0052740	1-acyl-2-lysophosphatidylserine acylhydrolase activity	IEA	molecular function
GO:0052739	phosphatidylserine 1-acylhydrolase activity	IEA	molecular function
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0051004	regulation of lipoprotein lipase activity	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0030301	cholesterol transport	IEA	biological process
GO:0016298	lipase activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0004620	phospholipase activity	TAS	molecular function
GO:0034185	apolipoprotein binding	ISS	molecular function
GO:0004806	triglyceride lipase activity	IDA	molecular function
GO:0004806	triglyceride lipase activity	IDA	molecular function
GO:0030169	low-density lipoprotein particle binding	ISS	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0006633	fatty acid biosynthetic process	IDA	biological process
GO:0019433	triglyceride catabolic process	IDA	biological process
GO:0019433	triglyceride catabolic process	IDA	biological process
GO:0019433	triglyceride catabolic process	IDA	biological process
GO:0034372	very-low-density lipoprotein particle remodeling	IDA	biological process
GO:0043691	reverse cholesterol transport	IC	biological process
GO:0034373	intermediate-density lipoprotein particle remodeling	TAS	biological process
GO:0034375	high-density lipoprotein particle remodeling	IMP	biological process
GO:0042632	cholesterol homeostasis	IMP	biological process
GO:0070328	triglyceride homeostasis	IMP	biological process
GO:0034374	low-density lipoprotein particle remodeling	IMP	biological process
GO:0034382	chylomicron remnant clearance	TAS	biological process
GO:0034638	phosphatidylcholine catabolic process	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00561	Glycerolipid metabolism
hsa04979	Cholesterol metabolism

Diseases

Associated diseases	References
Hepatic lipase deficiency	KEGG:H02329
Hepatic lipase deficiency	KEGG:H02329
Alzheimer's disease	PMID:17175070
Familial combined hyperlipidemia	PMID:16338252
Hyperinsulinism	PMID:11095452
Hyperinsulinism	PMID:1592086
Coronary artery disease	PMID:11916946
Coronary artery disease	PMID:15099346
Peripheral vascular disease	PMID:18413186
Kidney disease	PMID:15983323
type 2 diabetes mellitus	PMID:16429317
type 2 diabetes mellitus	PMID:15656877
type 1 diabetes mellitus	PMID:9580247
obesity	PMID:12843191
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq