• Gene id: 399

Gene Summary

• Gene Symbol: RHOH   Gene   UCSC   Ensembl
• Aliases: ARHH, TTF
• Gene name: ras homolog family member H
• Alternate names: rho-related GTP-binding protein RhoH, GTP-binding protein TTF, TTF, translocation three four, ras homolog gene family, member H,
• Gene location: 4p14 (40191079: 40246966)     Exons: 11     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the Ras superfamily of guanosine triphosphate (GTP)-metabolizing enzymes. The encoded protein is expressed in hematopoietic cells, where it functions as a negative regulator of cell growth and survival. This
• OMIM: 608887

Protein Summary

• Protein general information: Q15669  
  • Name: Rho related GTP binding protein RhoH (GTP binding protein TTF) (Translocation three four protein)
  • Length: 191  
  • Mass: 21331
  • Tissue specificity: Expressed only in hematopoietic cells. Present at very high levels in the thymus, less abundant in the spleen, and least abundant in the bone marrow. Expressed at a higher level in the TH1 subtype of T-helper cells than in the TH2 subp
• Sequence:

  MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQ
  ADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLE
  CSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR003578  
  • Prosite: PS51420
  • STRING: ENSP00000371219
• Other Databases: GeneCards:  RHOH  Malacards:  RHOH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022407	regulation of cell-cell adhesion	IBA	biological process
GO:0005525	GTP binding	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:0045595	regulation of cell differentiation	IBA	biological process
GO:0045582	positive regulation of T cell differentiation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001772	immunological synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045576	mast cell activation	IEA	biological process
GO:0030217	T cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0033673	negative regulation of kinase activity	IEA	biological process
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0005525	GTP binding	IDA	molecular function
GO:0019210	kinase inhibitor activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0030217	T cell differentiation	NAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0017048	Rho GTPase binding	NAS	molecular function
GO:0005095	GTPase inhibitor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa04670	Leukocyte transendothelial migration

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R