• Gene id: 3985

Gene Summary

• Gene Symbol: LIMK2   Gene   UCSC   Ensembl
• Gene name: LIM domain kinase 2
• Alternate names: LIM domain kinase 2,
• Gene location: 22q12.2 (31212263: 31280079)     Exons: 18     NC_000022.11
• Gene summary(Entrez): There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the
• OMIM: 601988

Protein Summary

• Protein general information: P53671  
  • Name: LIM domain kinase 2 (LIMK 2) (EC 2.7.11.1)
  • Length: 638  
  • Mass: 72,232
• Sequence:

  MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNWYYEKDGKLYCPKDYWGKFGEFCHGC
  SLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTESVQEQLPYSV
  TLISMPATTEGRRGFSVSVESACSNYATTVQVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAIS
  QTSQTLQLLIEHDPVSQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPK
  EPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLT
  EVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMAYLHSMCIIHR
  DLNSHNCLIKLDKTVVVADFGLSRLIVEERKRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDE
  TVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDS
  FEALSLYLGELGIPLPAELEELDHTVSMQYGLTRDSPP

• Structural information:
  • Protein Domains: LIM (12-63)
    LIM (72-124)
    PDZ. (152-239)
    Protein (331-608)
  • Interpro: IPR011009  IPR001478  IPR036034  IPR000719  IPR017441   IPR001245  IPR001781  
  • Prosite: PS00478 PS50023 PS50106 PS00107 PS50011
  • PDB: 1X6A 4TPT 5NXD
  • PDBsum: 1X6A 4TPT 5NXD
  • STRING: ENSP00000339916
• Other Databases: GeneCards:  LIMK2  Malacards:  LIMK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016310	phosphorylation	TAS	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016310	phosphorylation	TAS	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0016310	phosphorylation	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa04666	Fc gamma R-mediated phagocytosis
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Associated diseases	References
Diabetic nephropathy	GAD: 21150874
Diabetes	GAD: 21150874
Oligozoospermia	GAD: 19369647
Azoospermia	MIK: 19369647
Male factor infertility	MIK: 19369647
Chronic renal failure	GAD: 21085059
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Male infertility	MIK: 19369647
Plays a role in proper progression of spermatogenesis by regulation of cofilin activity and/or localization in germ cells	MIK: 11784110
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19369647	Male infertility	SBF1 (T5A, F75L, E335K, K486E, R1059K, A1119V, L1693V), LIMK2 (G35S, D45N, R213C, P296R, R418C), LIPE(Y100H, Q127H, P146S, S177T, A194V, R217Q, R217L, K497N, N499H, R611C, G742R, R938S)		78 infertile men	Male infertility	SBF1 LIMK2 LIPE TBPL1
11784110	Plays a role in proper progression of spermatogenesis by regulation of cofilin activity and/or localization in germ cells				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881