• Gene id: 3984

Gene Summary

• Gene Symbol: LIMK1   Gene   UCSC   Ensembl
• Aliases: LIMK, LIMK-1
• Gene name: LIM domain kinase 1
• Alternate names: LIM domain kinase 1, LIM motif-containing protein kinase,
• Gene location: 7q11.23 (74083803: 74122524)     Exons: 17     NC_000007.14
• Gene summary(Entrez): There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the
• OMIM: 610891

Protein Summary

• Protein general information: P53667  
  • Name: LIM domain kinase 1 (LIMK 1) (EC 2.7.11.1)
  • Length: 647  
  • Mass: 72585
  • Tissue specificity: Highest expression in both adult and fetal nervous system. Detected ubiquitously throughout the different regions of adult brain, with highest levels in the cerebral cortex. Expressed to a lesser extent in heart and skeletal muscle.
• Sequence:

  MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKD
  YWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQI
  LPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILE
  INGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSID
  RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDE
  ETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAY
  LHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRS
  YDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
  EHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD

• Structural information:
  • Protein Domains: (25..7-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (84..13-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (165..25-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-P-)
  • Interpro: IPR011009  IPR001478  IPR036034  IPR000719  IPR017441   IPR001245  IPR001781  
  • Prosite: PS00478 PS50023 PS50106 PS00107 PS50011
  • PDB: 3S95 5HVJ 5HVK 5L6W 5NXC
  • PDBsum: 3S95 5HVJ 5HVK 5L6W 5NXC
  • DIP: 31605
  • STRING: ENSP00000336740
• Other Databases: GeneCards:  LIMK1  Malacards:  LIMK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0051496	positive regulation of stress fiber assembly	IBA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0045773	positive regulation of axon extension	ISS	biological process
GO:0043005	neuron projection	ISS	cellular component
GO:0030027	lamellipodium	ISS	cellular component
GO:0006468	protein phosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004672	protein kinase activity	NAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007266	Rho protein signal transduction	TAS	biological process
GO:0030036	actin cytoskeleton organization	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0031072	heat shock protein binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032233	positive regulation of actin filament bundle assembly	IDA	biological process
GO:0051444	negative regulation of ubiquitin-protein transferase activity	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa05135	Yersinia infection
hsa04666	Fc gamma R-mediated phagocytosis

Diseases

Associated diseases	References
Williams-Beuren syndrome	KEGG:H01439
Williams-Beuren syndrome	KEGG:H01439
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq