• Gene id: 3980

Gene Summary

• Gene Symbol: LIG3   Gene   UCSC   Ensembl
• Aliases: LIG2, LIG3alpha
• Gene name: DNA ligase 3
• Alternate names: DNA ligase 3, ligase II, DNA, ATP-dependent, ligase III, DNA, ATP-dependent, polydeoxyribonucleotide synthase [ATP] 3,
• Gene location: 17q12 (34980497: 35009742)     Exons: 22     NC_000017.11
• Gene summary(Entrez): This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and i
• OMIM: 603027

Protein Summary

• Protein general information: P49916  
  • Name: DNA ligase 3 (EC 6.5.1.1) (DNA ligase III) (Polydeoxyribonucleotide synthase [ATP] 3)
  • Length: 1009  
  • Mass: 112907
  • Tissue specificity: Testis, thymus, prostate and heart.
• Sequence:

  MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQGSHLRSRATYLVFLP
  GLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHIKCMFEKLERA
  RATTKKIEDLTELEGWEELEDNEKEQITQHIADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRK
  FSGFSAKPNNSGEAPSSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
  GDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQ
  EVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDV
  VERVLHNAQEVEKEPGQRRALSVQASLMTPVQPMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSY
  FSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
  NDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQEGLEGLVLKDVKGTYEPGKRHWLK
  VKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGSQKWCTVTKCAGGHDDATLARLQNELDMVKI
  SKDPSKIPSWLKVNKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQL
  KELYQLSKEKADFTVVAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPS
  AMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSA
  THVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC

• Structural information:
  • Protein Domains: (933..100-)
    (/note="BRCT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00033"-)
  • Interpro: IPR001357  IPR036420  IPR000977  IPR012309  IPR012310   IPR016059  IPR012308  IPR036599  IPR031916  IPR012340  IPR001510  IPR036957  
  • Prosite: PS50172 PS00697 PS00333 PS50160 PS00347 PS50064
  • PDB: 1IMO 1IN1 1UW0 3L2P 3PC7 3PC8 3QVG
  • PDBsum: 1IMO 1IN1 1UW0 3L2P 3PC7 3PC8 3QVG
  • STRING: ENSP00000367787
• Other Databases: GeneCards:  LIG3  Malacards:  LIG3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090298	negative regulation of mitochondrial DNA replication	IMP	biological process
GO:0003910	DNA ligase (ATP) activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0006266	DNA ligation	IBA	biological process
GO:0006273	lagging strand elongation	IBA	biological process
GO:0006288	base-excision repair, DNA ligation	IBA	biological process
GO:0043504	mitochondrial DNA repair	IBA	biological process
GO:0051103	DNA ligation involved in DNA repair	IBA	biological process
GO:0006281	DNA repair	IBA	biological process
GO:0070421	DNA ligase III-XRCC1 complex	IBA	cellular component
GO:0097681	double-strand break repair via alternative nonhomologous end joining	IBA	biological process
GO:0003909	DNA ligase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003910	DNA ligase (ATP) activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006310	DNA recombination	IEA	biological process
GO:0051103	DNA ligation involved in DNA repair	IEA	biological process
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0006310	DNA recombination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0003910	DNA ligase (ATP) activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000724	double-strand break repair via homologous recombination	TAS	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0006288	base-excision repair, DNA ligation	TAS	biological process
GO:0003909	DNA ligase activity	TAS	molecular function
GO:0003909	DNA ligase activity	TAS	molecular function
GO:0003909	DNA ligase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006297	nucleotide-excision repair, DNA gap filling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006288	base-excision repair, DNA ligation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003909	DNA ligase activity	IEA	molecular function
GO:0006288	base-excision repair, DNA ligation	IDA	biological process
GO:0006302	double-strand break repair	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0033151	V(D)J recombination	IDA	NOT|biological process
GO:0003909	DNA ligase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03410	Base excision repair

Diseases

Associated diseases	References
pancreatic cancer	PMID:19147782
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray