• Gene id: 3976

Gene Summary

• Gene Symbol: LIF   Gene   UCSC   Ensembl
• Aliases: CDF, DIA, HILDA, MLPLI
• Gene name: LIF, interleukin 6 family cytokine
• Alternate names: leukemia inhibitory factor, D factor, cholinergic differentiation factor, differentiation inhibitory activity, differentiation-inducing factor, differentiation-stimulating factor, hepatocyte-stimulating factor III, human interleukin in DA cells, melanoma-,
• Gene location: 22q12.2 (30257486: 30240446)     Exons: 5     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulato
• OMIM: 159540

Protein Summary

• Protein general information: P15018  
  • Name: Leukemia inhibitory factor (LIF) (Differentiation stimulating factor) (D factor) (Melanoma derived LPL inhibitor) (MLPLI) (Emfilermin)
  • Length: 202  
  • Mass: 22,008
  • Tissue specificity: Detected in primary breast cancer tissues but undetectable in normal breast tissues in Sudanese patients. Isoform 1 is expressed in adult and fetal skeletal muscle and cardiac tissues, with higher expression levels in the cardiac tissu
• Sequence:

  MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFP
  NNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSN
  VLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

• Structural information:
  • Interpro: IPR009079  IPR003624  IPR001581  IPR019827  
  • Prosite: PS00590
  • PDB: 1EMR 1PVH 2Q7N
  • PDBsum: 1EMR 1PVH 2Q7N
  • DIP: 5769
  • STRING: ENSP00000249075
• Other Databases: GeneCards:  LIF  Malacards:  LIF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001135	transcription factor activity, RNA polymerase II transcription factor recruiting	IDA	molecular function
GO:0001974	blood vessel remodeling	IEA	biological process
GO:0005102	receptor binding	IPI	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005146	leukemia inhibitory factor receptor binding	IDA	molecular function
GO:0005146	leukemia inhibitory factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IC	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0007566	embryo implantation	IEA	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0033141	positive regulation of peptidyl-serine phosphorylation of STAT protein	IDA	biological process
GO:0042503	tyrosine phosphorylation of Stat3 protein	IEA	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045651	positive regulation of macrophage differentiation	IDA	biological process
GO:0045835	negative regulation of meiotic nuclear division	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046697	decidualization	IEA	biological process
GO:0046888	negative regulation of hormone secretion	IDA	biological process
GO:0048286	lung alveolus development	IEA	biological process
GO:0048644	muscle organ morphogenesis	IEA	biological process
GO:0048666	neuron development	IEA	biological process
GO:0048708	astrocyte differentiation	IEA	biological process
GO:0048711	positive regulation of astrocyte differentiation	IEA	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0048863	stem cell differentiation	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0051461	positive regulation of corticotropin secretion	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0060290	transdifferentiation	IEA	biological process
GO:0060426	lung vasculature development	IEA	biological process
GO:0060463	lung lobe morphogenesis	IEA	biological process
GO:0060707	trophoblast giant cell differentiation	IEA	biological process
GO:0060708	spongiotrophoblast differentiation	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0072108	positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	IDA	biological process
GO:0072307	regulation of metanephric nephron tubule epithelial cell differentiation	IDA	biological process
GO:1900182	positive regulation of protein localization to nucleus	IDA	biological process
GO:1901676	positive regulation of histone H3-K27 acetylation	IDA	biological process
GO:1903025	regulation of RNA polymerase II regulatory region sequence-specific DNA binding	IEA	biological process
GO:0001135	transcription factor activity, RNA polymerase II transcription factor recruiting	IDA	molecular function
GO:0001974	blood vessel remodeling	IEA	biological process
GO:0005102	receptor binding	IPI	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005146	leukemia inhibitory factor receptor binding	IEA	molecular function
GO:0005146	leukemia inhibitory factor receptor binding	IEA	molecular function
GO:0005146	leukemia inhibitory factor receptor binding	IDA	molecular function
GO:0005146	leukemia inhibitory factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IC	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0007566	embryo implantation	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0033141	positive regulation of peptidyl-serine phosphorylation of STAT protein	IDA	biological process
GO:0042503	tyrosine phosphorylation of Stat3 protein	IEA	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045595	regulation of cell differentiation	IEA	biological process
GO:0045651	positive regulation of macrophage differentiation	IDA	biological process
GO:0045835	negative regulation of meiotic nuclear division	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046697	decidualization	IEA	biological process
GO:0046888	negative regulation of hormone secretion	IDA	biological process
GO:0048286	lung alveolus development	IEA	biological process
GO:0048644	muscle organ morphogenesis	IEA	biological process
GO:0048666	neuron development	IEA	biological process
GO:0048708	astrocyte differentiation	IEA	biological process
GO:0048711	positive regulation of astrocyte differentiation	IEA	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0048863	stem cell differentiation	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0051461	positive regulation of corticotropin secretion	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0060290	transdifferentiation	IEA	biological process
GO:0060426	lung vasculature development	IEA	biological process
GO:0060463	lung lobe morphogenesis	IEA	biological process
GO:0060707	trophoblast giant cell differentiation	IEA	biological process
GO:0060708	spongiotrophoblast differentiation	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0072108	positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	IDA	biological process
GO:0072307	regulation of metanephric nephron tubule epithelial cell differentiation	IDA	biological process
GO:1900182	positive regulation of protein localization to nucleus	IDA	biological process
GO:1901676	positive regulation of histone H3-K27 acetylation	IDA	biological process
GO:1903025	regulation of RNA polymerase II regulatory region sequence-specific DNA binding	IEA	biological process
GO:0001135	transcription factor activity, RNA polymerase II transcription factor recruiting	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005146	leukemia inhibitory factor receptor binding	IDA	molecular function
GO:0005146	leukemia inhibitory factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IC	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0007275	multicellular organism development	TAS	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0033141	positive regulation of peptidyl-serine phosphorylation of STAT protein	IDA	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0042517	positive regulation of tyrosine phosphorylation of Stat3 protein	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045651	positive regulation of macrophage differentiation	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046888	negative regulation of hormone secretion	IDA	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0048861	leukemia inhibitory factor signaling pathway	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0072108	positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	IDA	biological process
GO:0072307	regulation of metanephric nephron tubule epithelial cell differentiation	IDA	biological process
GO:1900182	positive regulation of protein localization to nucleus	IDA	biological process
GO:1901676	positive regulation of histone H3-K27 acetylation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04550	Signaling pathways regulating pluripotency of stem cells

Diseases

Associated diseases	References
Cleft defects	GAD: 11587067
Cleft defects	GAD: 11587067
Multiple sclerosis	GAD: 16263181
Inflammatory bowel disease	GAD: 19915574
Obesity	GAD: 20734064
Bone diseases	GAD: 19453261
Dementia	GAD: 19550366
Schizophrenia	GAD: 19879916
Psychological disorders	GAD: 19086053
Several psychiatric disorders	GAD: 19086053
Abortion	GAD: 20587610
Endometriosis	GAD: 19545488
Embryo implantation	INFBASE: 23876532
Female infertility	INFBASE: 8610178
Multiple implantation failure	INFBASE: 23541977
Endometrial receptivity	INFBASE: 19542542
Implantation failure	INFBASE: 16274610
Endometrial receptivity	INFBASE: 15142989
Recurrent implantation failure (RIF)	INFBASE: 22537815
Infertility	INFBASE: 14688825
Recurrent pregnancy loss (RPL)	INFBASE: 14688825
Recurrent implantation failure (RIF)	INFBASE: 9506211
Female infertility	INFBASE: 23900753
Polycystic ovary syndrome (PCOS)	INFBASE: 11574494
Primary unexplained infertility	INFBASE: 22520363
Successful pregnancy	INFBASE: 19374770
Recurrent pregnancy loss (RPL)	INFBASE: 26368793
Recurrent pregnancy loss (RPL)	INFBASE: 26368793
Unexplained infertility	INFBASE: 14687743
Unexplained infertility	INFBASE: 11783352
Adenomyosis	INFBASE: 19361790
Blocking implantation	INFBASE: 19213836
Hydrosalpinx	INFBASE: 16024536
Male Infertility	MIK: 20576636

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20576636	Infertility			96 (male infertility, n = 61; female infertility factors, n = 35)	Male infertility, Female infertility