• Gene id: 3965

Gene Summary

• Gene Symbol: LGALS9   Gene   UCSC   Ensembl
• Aliases: HUAT, LGALS9A
• Gene name: galectin 9
• Alternate names: galectin-9, ecalectin, gal-9, lectin, galactoside-binding, soluble, 9, tumor antigen HOM-HD-21, urate transporter/channel protein,
• Gene location: 17q11.2 (27631171: 27649559)     Exons: 12     NC_000017.11
• Gene summary(Entrez): The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in
• OMIM: 601879

Protein Summary

• Protein general information: O00182  
  • Name: Galectin 9 (Gal 9) (Ecalectin) (Tumor antigen HOM HD 21)
  • Length: 355  
  • Mass: 39518
  • Tissue specificity: Peripheral blood leukocytes and lymphatic tissues. Expressed in lung, liver, breast and kidney with higher levels in tumor endothelial cells than normal endothelium (at protein level) (PubMed
• Sequence:

  MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCN
  TRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNP
  RTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPM
  PFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPF
  VRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

• Structural information:
  • Protein Domains: (17..14-)
    (/note="Galectin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00639-)
    (227..35-)
    (/note="Galectin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00639"-)
  • Interpro: IPR013320  IPR001079  
  • Prosite: PS51304
  • CDD: cd00070
  • PDB: 2EAK 2EAL 2YY1 2ZHK 2ZHL 2ZHM 2ZHN 3LSD 3LSE 3NV1 3NV2 3NV3 3NV4 3WLU 3WV6
  • PDBsum: 2EAK 2EAL 2YY1 2ZHK 2ZHL 2ZHM 2ZHN 3LSD 3LSE 3NV1 3NV2 3NV3 3NV4 3WLU 3WV6
  • STRING: ENSP00000378856
• Other Databases: GeneCards:  LGALS9  Malacards:  LGALS9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010629	negative regulation of gene expression	IBA	biological process
GO:0016936	galactoside binding	IBA	molecular function
GO:0030246	carbohydrate binding	IBA	molecular function
GO:0032689	negative regulation of interferon-gamma production	IBA	biological process
GO:2000562	negative regulation of CD4-positive, alpha-beta T cell proliferation	IBA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IBA	biological process
GO:2001181	positive regulation of interleukin-10 secretion	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0010628	positive regulation of gene expression	IBA	biological process
GO:0030246	carbohydrate binding	IDA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005534	galactose binding	TAS	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006954	inflammatory response	IDA	biological process
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0070555	response to interleukin-1	IDA	biological process
GO:0060135	maternal process involved in female pregnancy	IDA	biological process
GO:2000562	negative regulation of CD4-positive, alpha-beta T cell proliferation	IDA	biological process
GO:0071636	positive regulation of transforming growth factor beta production	IDA	biological process
GO:0032834	positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved in immune response	IDA	biological process
GO:2000670	positive regulation of dendritic cell apoptotic process	IDA	biological process
GO:0045953	negative regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0070371	ERK1 and ERK2 cascade	IDA	biological process
GO:2000667	positive regulation of interleukin-13 secretion	IDA	biological process
GO:0032753	positive regulation of interleukin-4 production	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0032689	negative regulation of interferon-gamma production	IDA	biological process
GO:0046598	positive regulation of viral entry into host cell	IDA	biological process
GO:2001181	positive regulation of interleukin-10 secretion	IDA	biological process
GO:0032673	regulation of interleukin-4 production	IDA	NOT|biological process
GO:0034142	toll-like receptor 4 signaling pathway	IDA	NOT|biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0070241	positive regulation of activated T cell autonomous cell death	IDA	biological process
GO:2001181	positive regulation of interleukin-10 secretion	IDA	biological process
GO:0032674	regulation of interleukin-5 production	IDA	NOT|biological process
GO:2000563	positive regulation of CD4-positive, alpha-beta T cell proliferation	IDA	biological process
GO:2001190	positive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IDA	biological process
GO:0007565	female pregnancy	IDA	biological process
GO:0038066	p38MAPK cascade	IDA	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0034134	toll-like receptor 2 signaling pathway	IDA	NOT|biological process
GO:1902715	positive regulation of interferon-gamma secretion	IDA	biological process
GO:0050718	positive regulation of interleukin-1 beta secretion	IDA	biological process
GO:1904469	positive regulation of tumor necrosis factor secretion	IDA	biological process
GO:1900744	regulation of p38MAPK cascade	IMP	NOT|biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process
GO:0097029	mature conventional dendritic cell differentiation	IMP	NOT|biological process
GO:2000510	positive regulation of dendritic cell chemotaxis	IMP	biological process
GO:0046007	negative regulation of activated T cell proliferation	IMP	biological process
GO:0032753	positive regulation of interleukin-4 production	IMP	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IMP	biological process
GO:2001184	positive regulation of interleukin-12 secretion	IMP	biological process
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0071639	positive regulation of monocyte chemotactic protein-1 production	IMP	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IMP	biological process
GO:0043305	negative regulation of mast cell degranulation	IMP	biological process
GO:0032496	response to lipopolysaccharide	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0002519	natural killer cell tolerance induction	IMP	biological process
GO:0032682	negative regulation of chemokine production	IMP	biological process
GO:2001184	positive regulation of interleukin-12 secretion	IMP	biological process
GO:2000484	positive regulation of interleukin-8 secretion	IMP	biological process
GO:0098586	cellular response to virus	IMP	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:2001200	positive regulation of dendritic cell differentiation	IMP	biological process
GO:2001269	positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	biological process
GO:0048030	disaccharide binding	IMP	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq