• Gene id: 3960

Gene Summary

• Gene Symbol: LGALS4   Gene   UCSC   Ensembl
• Aliases: GAL4, L36LBP
• Gene name: galectin 4
• Alternate names: galectin-4, L-36 lactose-binding protein, antigen NY-CO-27, gal-4, lactose-binding lectin 4, lectin, galactoside-binding, soluble, 4,
• Gene location: 19q13.2 (38813613: 38801670)     Exons: 10     NC_000019.10
• Gene summary(Entrez): The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer
• OMIM: 613196

Protein Summary

• Protein general information: P56470  
  • Name: Galectin 4 (Gal 4) (Antigen NY CO 27) (L 36 lactose binding protein) (L36LBP) (Lactose binding lectin 4)
  • Length: 323  
  • Mass: 35941
• Sequence:

  MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVV
  FNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFI
  GGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINF
  KVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHR
  LSAFQRVDTLEIQGDVTLSYVQI

• Structural information:
  • Protein Domains: (19..15-)
    (/note="Galectin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00639-)
    (194..32-)
    (/note="Galectin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00639"-)
  • Interpro: IPR013320  IPR015533  IPR001079  
  • Prosite: PS51304
  • CDD: cd00070
  • PDB: 1X50 4XZP 4YLZ 4YM0 4YM1 4YM2 4YM3 5CBL 5DUU 5DUV 5DUW 5DUX
  • PDBsum: 1X50 4XZP 4YLZ 4YM0 4YM1 4YM2 4YM3 5CBL 5DUU 5DUV 5DUW 5DUX
  • STRING: ENSP00000302100
• Other Databases: GeneCards:  LGALS4  Malacards:  LGALS4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0016936	galactoside binding	IEA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0016936	galactoside binding	IEA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq