• Gene id: 3959

Gene Summary

• Gene Symbol: LGALS3BP   Gene   UCSC   Ensembl
• Aliases: 90K, BTBD17B, CyCAP, M2BP, MAC-2-BP, TANGO10B, gp90
• Gene name: galectin 3 binding protein
• Alternate names: galectin-3-binding protein, L3 antigen, MAC2BP, Mac-2-binding protein, basement membrane autoantigen p105, lectin galactoside-binding soluble 3-binding protein, mac-2 BP, serum protein 90K, transport and golgi organization 10 homolog B, tumor-associated a,
• Gene location: 17q25.3 (78979978: 78971252)     Exons: 6     NC_000017.11
• Gene summary(Entrez): The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency viru
• OMIM: 600626

Protein Summary

• Protein general information: Q08380  
  • Name: Galectin 3 binding protein (Basement membrane autoantigen p105) (Lectin galactoside binding soluble 3 binding protein) (Mac 2 binding protein) (MAC2BP) (Mac 2 BP) (Tumor associated antigen 90K)
  • Length: 585  
  • Mass: 65,331
• Sequence:

  MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALG
  RAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQ
  RGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVK
  CFHKLASAYGARQLQGYCASLFAILLPQDPSFQMPLDLYAYAVATGDALLEKLCLQFLAWNFEALTQAEAWPSVP
  TDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEGLVEKIRFPMMLPEELFELQFNLSLYWSHEALFQK
  KTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTSPTWSAFVTDSSWSARKSQLVYQSRRGPLVKYSSDYFQAP
  SDYRYYPYQSFQTPQHPSFLFQDKRVSWSLVYLPTIQSCWNYGFSCSSDELPVLGLTKSGGSDRTIAYENKALML
  CEGLFVADVTDFEGWKAAIPSALDTNSSKSTSSFPCPAGHFNGFRTVIRPFYLTNSSGVD

• Structural information:
  • Protein Domains: SRCR. (24-124)
    BTB. (153-221)
    BACK. (260-360)
  • Interpro: IPR011705  IPR000210  IPR001190  IPR017448  IPR036772  
  • Prosite: PS50097 PS00420 PS50287
  • PDB: 1BY2
  • PDBsum: 1BY2
  • STRING: ENSP00000262776
• Other Databases: GeneCards:  LGALS3BP  Malacards:  LGALS3BP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002576	platelet degranulation	TAS	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072562	blood microparticle	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0002576	platelet degranulation	TAS	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0005044	scavenger receptor activity	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072562	blood microparticle	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0002576	platelet degranulation	TAS	biological process
GO:0005044	scavenger receptor activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006968	cellular defense response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072562	blood microparticle	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component

Diseases

Associated diseases	References
Cancer	GAD: 17091456
Cancer (thyroid)	GAD: 17091456
Oligoasthenozoospermia	MIK: 25779018
Male factor infertility	MIK: 25779018
Non obstructive azoospermia	MIK: 23427166
Non obstructive azoospermia	MIK: 23427166
Cryptorchidism	MIK: 28606200
Oligoasthenozoospermia	MIK: 25729253
Non-obstructive azoospermia	MIK: 23427166
Male infertility	MIK: 25779018
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23427166	Non-obstructive azoospermia			40 men with NOA	Male infertility
25779018	Oligoasthenozoospermia			20 (10 men with normozoospermia, 10 men with idiopathic oligoasthenozoospermia)	Male infertility
25729253	idiopathic oligoasthenozoospermia			20 (10 men with normozoospermia, 10 men with idiopathic oligoasthenozoospermia)	Male infertility
25779018	Oligoasthenozoospermia, Male infertility			20 (10 men with normozoospermia, 10 men with idiopathic oligoasthenozoospermia)	Male infertility
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R