• Gene id: 3957

Gene Summary

• Gene Symbol: LGALS2   Gene   UCSC   Ensembl
• Aliases: HL14
• Gene name: galectin 2
• Alternate names: galectin-2, S-Lac lectin 2, beta-galactoside-binding lectin L-14-II, gal-2, lactose-binding lectin 2, lectin, galactoside-binding, soluble, 2,
• Gene location: 22q13.1 (37580086: 37570247)     Exons: 4     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is a soluble beta-galactoside binding lectin. The encoded protein is found as a homodimer and can bind to lymphotoxin-alpha. A single nucleotide polymorphism in an intron of this gene can alter the transcriptional level of

Protein Summary

• Protein general information: P05162  
  • Name: Galectin 2 (Gal 2) (Beta galactoside binding lectin L 14 II) (HL14) (Lactose binding lectin 2) (S Lac lectin 2)
  • Length: 132  
  • Mass: 14644
• Sequence:

  MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLC
  FSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE

• Structural information:
  • Protein Domains: (4..13-)
    (/note="Galectin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00639"-)
  • Interpro: IPR013320  IPR001079  
  • Prosite: PS51304
  • CDD: cd00070
  • PDB: 1HLC 5DG1 5DG2 5EWS
  • PDBsum: 1HLC 5DG1 5DG2 5EWS
  • STRING: ENSP00000215886
• Other Databases: GeneCards:  LGALS2  Malacards:  LGALS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016936	galactoside binding	IBA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016936	galactoside binding	IEA	molecular function
GO:0016936	galactoside binding	IBA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016936	galactoside binding	IEA	molecular function

Diseases

Associated diseases	References
Myocardial infarction	PMID:15129282
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881