• Gene id: 3955

Gene Summary

• Gene Symbol: LFNG   Gene   UCSC   Ensembl
• Aliases: SCDO3
• Gene name: LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
• Alternate names: beta-1,3-N-acetylglucosaminyltransferase lunatic fringe,
• Gene location: 7p22.3 (2512528: 2529176)     Exons: 13     NC_000007.14
• Gene summary(Entrez): This gene is a member of the glycosyltransferase 31 gene family. Members of this gene family, which also includes the MFNG (GeneID: 4242) and RFNG (GeneID: 5986) genes, encode evolutionarily conserved glycosyltransferases that act in the Notch signaling p
• OMIM: 601329

Protein Summary

• Protein general information: Q8NES3  
  • Name: Beta 1,3 N acetylglucosaminyltransferase lunatic fringe (EC 2.4.1.222) (O fucosylpeptide 3 beta N acetylglucosaminyltransferase)
  • Length: 379  
  • Mass: 41773
• Sequence:

  MLKRCGRRLLLALAGALLACLLVLTADPPPPPLPAERGRRALRSLAGPAGAAPAPGLGAAAAAPGALVRDVHSLS
  EYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTKKFHRARLDLLLETWISRHKEMTFIFTD
  GEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYV
  GKPSLDRPIQAMERVSENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPDDCTIGYIVEAL
  LGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIHCHLYPDTPWCPR
  TAIF

• Structural information:
  • Interpro: IPR017374  IPR003378  
  • STRING: ENSP00000222725
• Other Databases: GeneCards:  LFNG  Malacards:  LFNG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008375	acetylglucosaminyltransferase activity	IBA	molecular function
GO:0036066	protein O-linked fucosylation	IBA	biological process
GO:0033829	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity	IBA	molecular function
GO:0008593	regulation of Notch signaling pathway	IBA	biological process
GO:1902367	negative regulation of Notch signaling pathway involved in somitogenesis	ISS	biological process
GO:0001756	somitogenesis	ISS	biological process
GO:0030217	T cell differentiation	ISS	biological process
GO:0002315	marginal zone B cell differentiation	ISS	biological process
GO:0030173	integral component of Golgi membrane	IEA	cellular component
GO:0007389	pattern specification process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0033829	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0033829	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0033829	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0001541	ovarian follicle development	IEA	biological process
GO:0014807	regulation of somitogenesis	IEA	biological process
GO:0032092	positive regulation of protein binding	IEA	biological process
GO:0045747	positive regulation of Notch signaling pathway	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0002315	marginal zone B cell differentiation	IEA	biological process
GO:0007386	compartment pattern specification	IEA	biological process
GO:0008593	regulation of Notch signaling pathway	IEA	biological process
GO:0030217	T cell differentiation	IEA	biological process
GO:0033829	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0036066	protein O-linked fucosylation	IEA	biological process
GO:0051446	positive regulation of meiotic cell cycle	IEA	biological process
GO:1902367	negative regulation of Notch signaling pathway involved in somitogenesis	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0014807	regulation of somitogenesis	IMP	biological process
GO:1903561	extracellular vesicle	HDA	cellular component
GO:0033829	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity	ISS	molecular function
GO:0008593	regulation of Notch signaling pathway	ISS	biological process
GO:0009887	animal organ morphogenesis	NAS	biological process
GO:0005576	extracellular region	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05165	Human papillomavirus infection
hsa04330	Notch signaling pathway
hsa00514	Other types of O-glycan biosynthesis

Diseases

Associated diseases	References
Spondylocostal dysostosis	KEGG:H00517
Spondylocostal dysostosis	KEGG:H00517
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq