About Us

Search Result


Gene id 3952
Gene Summary     SNPs    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol LEP   Gene   UCSC   Ensembl
Aliases LEPD, OB, OBS
Gene name leptin
Alternate names leptin, leptin (murine obesity homolog), leptin (obesity homolog, mouse), obese protein, obese, mouse, homolog of, obesity factor,
Gene location 7q32.1 (128241200: 128257628)     Exons: 3     NC_000007.14
Gene summary(Entrez) This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathwa
OMIM 164160

SNPs


rs10244329

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.128248636A>T
NC_000007.13   g.127888689A>T
NG_007450.1   g.12359A>T|SEQ=[A/T]|GENE=LEP

Protein Summary

Protein general information P41159  

Name: Leptin (Obese protein) (Obesity factor)

Length: 167  Mass: 18,641

Sequence MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKM
DQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRL
QGSLQDMLWQLDLSPGC
Structural information
Interpro:  IPR009079  IPR000065  

PDB:  
1AX8
PDBsum:   1AX8

DIP:  

6116

STRING:   ENSP00000312652
Other Databases GeneCards:  LEP  Malacards:  LEP

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IEA biological process
GO:0001525 angiogenesis
IDA biological process
GO:0001525 angiogenesis
IDA biological process
GO:0001542 ovulation from ovarian fo
llicle
IEA biological process
GO:0001666 response to hypoxia
IEA biological process
GO:0001819 positive regulation of cy
tokine production
IEA biological process
GO:0001890 placenta development
IDA biological process
GO:0001936 regulation of endothelial
cell proliferation
IDA biological process
GO:0002021 response to dietary exces
s
IEA biological process
GO:0003300 cardiac muscle hypertroph
y
IEA biological process
GO:0005179 hormone activity
IBA molecular function
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
ISS cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0006006 glucose metabolic process
IEA biological process
GO:0006111 regulation of gluconeogen
esis
IEA biological process
GO:0006112 energy reserve metabolic
process
IEA biological process
GO:0006114 glycerol biosynthetic pro
cess
IEA biological process
GO:0006629 lipid metabolic process
IBA biological process
GO:0006635 fatty acid beta-oxidation
IEA biological process
GO:0007260 tyrosine phosphorylation
of STAT protein
IBA biological process
GO:0007565 female pregnancy
IEA biological process
GO:0007623 circadian rhythm
IEA biological process
GO:0008083 growth factor activity
IEA molecular function
GO:0008203 cholesterol metabolic pro
cess
IEA biological process
GO:0008206 bile acid metabolic proce
ss
IEA biological process
GO:0008217 regulation of blood press
ure
IEA biological process
GO:0008343 adult feeding behavior
ISS biological process
GO:0010507 negative regulation of au
tophagy
IDA biological process
GO:0010888 negative regulation of li
pid storage
IEA biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IDA biological process
GO:0014823 response to activity
IEA biological process
GO:0019953 sexual reproduction
IMP biological process
GO:0021954 central nervous system ne
uron development
IEA biological process
GO:0030073 insulin secretion
IEA biological process
GO:0030217 T cell differentiation
ISS biological process
GO:0030300 regulation of intestinal
cholesterol absorption
IEA biological process
GO:0032008 positive regulation of TO
R signaling
IDA biological process
GO:0032099 negative regulation of ap
petite
ISS biological process
GO:0032310 prostaglandin secretion
IDA biological process
GO:0032355 response to estradiol
IEA biological process
GO:0032814 regulation of natural kil
ler cell activation
IDA biological process
GO:0032817 regulation of natural kil
ler cell proliferation
IDA biological process
GO:0032868 response to insulin
IBA biological process
GO:0033197 response to vitamin E
IEA biological process
GO:0033210 leptin-mediated signaling
pathway
ISS biological process
GO:0033210 leptin-mediated signaling
pathway
ISS biological process
GO:0033686 positive regulation of lu
teinizing hormone secreti
on
IEA biological process
GO:0035360 positive regulation of pe
roxisome proliferator act
ivated receptor signaling
pathway
IEA biological process
GO:0035630 bone mineralization invol
ved in bone maturation
IEA biological process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
ISS biological process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
IBA biological process
GO:0042102 positive regulation of T
cell proliferation
IDA biological process
GO:0042269 regulation of natural kil
ler cell mediated cytotox
icity
IDA biological process
GO:0042445 hormone metabolic process
IEA biological process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
IEA biological process
GO:0042593 glucose homeostasis
IEA biological process
GO:0042755 eating behavior
IEA biological process
GO:0043066 negative regulation of ap
optotic process
IEA biological process
GO:0043270 positive regulation of io
n transport
IEA biological process
GO:0043410 positive regulation of MA
PK cascade
ISS biological process
GO:0043410 positive regulation of MA
PK cascade
IDA biological process
GO:0044320 cellular response to lept
in stimulus
IDA biological process
GO:0045471 response to ethanol
IEA biological process
GO:0045639 positive regulation of my
eloid cell differentiatio
n
IEA biological process
GO:0045765 regulation of angiogenesi
s
IDA biological process
GO:0045906 negative regulation of va
soconstriction
IEA biological process
GO:0046325 negative regulation of gl
ucose import
IDA biological process
GO:0046427 positive regulation of JA
K-STAT cascade
IDA biological process
GO:0046628 positive regulation of in
sulin receptor signaling
pathway
IEA biological process
GO:0046850 regulation of bone remode
ling
ISS biological process
GO:0046881 positive regulation of fo
llicle-stimulating hormon
e secretion
IEA biological process
GO:0048639 positive regulation of de
velopmental growth
IDA biological process
GO:0050796 regulation of insulin sec
retion
IEA biological process
GO:0050810 regulation of steroid bio
synthetic process
IEA biological process
GO:0050892 intestinal absorption
IDA biological process
GO:0050901 leukocyte tethering or ro
lling
IEA biological process
GO:0050999 regulation of nitric-oxid
e synthase activity
IDA biological process
GO:0051428 peptide hormone receptor
binding
IBA molecular function
GO:0051726 regulation of cell cycle
IDA biological process
GO:0051897 positive regulation of pr
otein kinase B signaling
ISS biological process
GO:0060587 regulation of lipoprotein
lipid oxidation
IEA biological process
GO:0060612 adipose tissue developmen
t
IEA biological process
GO:0061037 negative regulation of ca
rtilage development
IEA biological process
GO:0070093 negative regulation of gl
ucagon secretion
IEA biological process
GO:0071298 cellular response to L-as
corbic acid
IEA biological process
GO:0071300 cellular response to reti
noic acid
IEA biological process
GO:0072604 interleukin-6 secretion
IDA biological process
GO:0072606 interleukin-8 secretion
IDA biological process
GO:0090335 regulation of brown fat c
ell differentiation
ISS biological process
GO:0098868 bone growth
ISS biological process
GO:1900015 regulation of cytokine pr
oduction involved in infl
ammatory response
IDA biological process
GO:1900745 positive regulation of p3
8MAPK cascade
IDA biological process
GO:1904651 positive regulation of fa
t cell apoptotic process
IEA biological process
GO:1990051 activation of protein kin
ase C activity
IDA biological process
GO:2000366 positive regulation of ST
AT protein import into nu
cleus
IBA biological process
GO:2000379 positive regulation of re
active oxygen species met
abolic process
IEA biological process
GO:2000486 negative regulation of gl
utamine transport
IEA biological process
GO:2000491 positive regulation of he
patic stellate cell activ
ation
IEA biological process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IEA biological process
GO:0001525 angiogenesis
IDA biological process
GO:0001525 angiogenesis
IDA biological process
GO:0001542 ovulation from ovarian fo
llicle
IEA biological process
GO:0001666 response to hypoxia
IEA biological process
GO:0001819 positive regulation of cy
tokine production
IEA biological process
GO:0001890 placenta development
IDA biological process
GO:0001932 regulation of protein pho
sphorylation
IEA biological process
GO:0001936 regulation of endothelial
cell proliferation
IDA biological process
GO:0002021 response to dietary exces
s
IEA biological process
GO:0003300 cardiac muscle hypertroph
y
IEA biological process
GO:0005102 receptor binding
IEA molecular function
GO:0005179 hormone activity
IEA molecular function
GO:0005179 hormone activity
IEA molecular function
GO:0005179 hormone activity
IBA molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
IEA cellular component
GO:0005615 extracellular space
ISS cellular component
GO:0005615 extracellular space
TAS cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0006006 glucose metabolic process
IEA biological process
GO:0006111 regulation of gluconeogen
esis
IEA biological process
GO:0006112 energy reserve metabolic
process
IEA biological process
GO:0006112 energy reserve metabolic
process
TAS biological process
GO:0006114 glycerol biosynthetic pro
cess
IEA biological process
GO:0006629 lipid metabolic process
IEA biological process
GO:0006629 lipid metabolic process
IBA biological process
GO:0006635 fatty acid beta-oxidation
IEA biological process
GO:0007165 signal transduction
IEA biological process
GO:0007260 tyrosine phosphorylation
of STAT protein
IEA biological process
GO:0007260 tyrosine phosphorylation
of STAT protein
IBA biological process
GO:0007565 female pregnancy
IEA biological process
GO:0007584 response to nutrient
IEA biological process
GO:0007623 circadian rhythm
IEA biological process
GO:0008083 growth factor activity
IEA molecular function
GO:0008203 cholesterol metabolic pro
cess
IEA biological process
GO:0008206 bile acid metabolic proce
ss
IEA biological process
GO:0008217 regulation of blood press
ure
IEA biological process
GO:0008284 positive regulation of ce
ll proliferation
IEA biological process
GO:0008343 adult feeding behavior
IEA biological process
GO:0008343 adult feeding behavior
ISS biological process
GO:0009062 fatty acid catabolic proc
ess
IEA biological process
GO:0009892 negative regulation of me
tabolic process
IEA biological process
GO:0010507 negative regulation of au
tophagy
IEA biological process
GO:0010507 negative regulation of au
tophagy
IDA biological process
GO:0010888 negative regulation of li
pid storage
IEA biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IEA biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IDA biological process
GO:0014823 response to activity
IEA biological process
GO:0019222 regulation of metabolic p
rocess
IEA biological process
GO:0019953 sexual reproduction
IEA biological process
GO:0019953 sexual reproduction
IMP biological process
GO:0021954 central nervous system ne
uron development
IEA biological process
GO:0030073 insulin secretion
IEA biological process
GO:0030217 T cell differentiation
IEA biological process
GO:0030217 T cell differentiation
ISS biological process
GO:0030300 regulation of intestinal
cholesterol absorption
IEA biological process
GO:0031667 response to nutrient leve
ls
IEA biological process
GO:0032008 positive regulation of TO
R signaling
IDA biological process
GO:0032099 negative regulation of ap
petite
IEA biological process
GO:0032099 negative regulation of ap
petite
ISS biological process
GO:0032310 prostaglandin secretion
IDA biological process
GO:0032355 response to estradiol
IEA biological process
GO:0032814 regulation of natural kil
ler cell activation
IDA biological process
GO:0032817 regulation of natural kil
ler cell proliferation
IDA biological process
GO:0032868 response to insulin
IEA biological process
GO:0032868 response to insulin
IBA biological process
GO:0033197 response to vitamin E
IEA biological process
GO:0033210 leptin-mediated signaling
pathway
IEA biological process
GO:0033210 leptin-mediated signaling
pathway
ISS biological process
GO:0033210 leptin-mediated signaling
pathway
ISS biological process
GO:0033686 positive regulation of lu
teinizing hormone secreti
on
IEA biological process
GO:0035360 positive regulation of pe
roxisome proliferator act
ivated receptor signaling
pathway
IEA biological process
GO:0035556 intracellular signal tran
sduction
IEA biological process
GO:0035630 bone mineralization invol
ved in bone maturation
IEA biological process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
ISS biological process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
IBA biological process
GO:0042102 positive regulation of T
cell proliferation
IDA biological process
GO:0042269 regulation of natural kil
ler cell mediated cytotox
icity
IDA biological process
GO:0042307 positive regulation of pr
otein import into nucleus
IEA biological process
GO:0042445 hormone metabolic process
IEA biological process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
IEA biological process
GO:0042593 glucose homeostasis
IEA biological process
GO:0042755 eating behavior
IEA biological process
GO:0043066 negative regulation of ap
optotic process
IEA biological process
GO:0043270 positive regulation of io
n transport
IEA biological process
GO:0043410 positive regulation of MA
PK cascade
IEA biological process
GO:0043410 positive regulation of MA
PK cascade
ISS biological process
GO:0043410 positive regulation of MA
PK cascade
IDA biological process
GO:0044320 cellular response to lept
in stimulus
IDA biological process
GO:0045471 response to ethanol
IEA biological process
GO:0045598 regulation of fat cell di
fferentiation
IEA biological process
GO:0045639 positive regulation of my
eloid cell differentiatio
n
IEA biological process
GO:0045765 regulation of angiogenesi
s
IDA biological process
GO:0045906 negative regulation of va
soconstriction
IEA biological process
GO:0046325 negative regulation of gl
ucose import
IDA biological process
GO:0046427 positive regulation of JA
K-STAT cascade
IEA biological process
GO:0046427 positive regulation of JA
K-STAT cascade
IDA biological process
GO:0046628 positive regulation of in
sulin receptor signaling
pathway
IEA biological process
GO:0046850 regulation of bone remode
ling
IEA biological process
GO:0046850 regulation of bone remode
ling
ISS biological process
GO:0046881 positive regulation of fo
llicle-stimulating hormon
e secretion
IEA biological process
GO:0048639 positive regulation of de
velopmental growth
IDA biological process
GO:0050796 regulation of insulin sec
retion
IEA biological process
GO:0050810 regulation of steroid bio
synthetic process
IEA biological process
GO:0050892 intestinal absorption
IDA biological process
GO:0050901 leukocyte tethering or ro
lling
IEA biological process
GO:0050999 regulation of nitric-oxid
e synthase activity
IEA biological process
GO:0050999 regulation of nitric-oxid
e synthase activity
IDA biological process
GO:0051428 peptide hormone receptor
binding
IEA molecular function
GO:0051428 peptide hormone receptor
binding
IBA molecular function
GO:0051726 regulation of cell cycle
IEA biological process
GO:0051726 regulation of cell cycle
IDA biological process
GO:0051897 positive regulation of pr
otein kinase B signaling
IEA biological process
GO:0051897 positive regulation of pr
otein kinase B signaling
ISS biological process
GO:0060587 regulation of lipoprotein
lipid oxidation
IEA biological process
GO:0060612 adipose tissue developmen
t
IEA biological process
GO:0061037 negative regulation of ca
rtilage development
IEA biological process
GO:0070093 negative regulation of gl
ucagon secretion
IEA biological process
GO:0071298 cellular response to L-as
corbic acid
IEA biological process
GO:0071300 cellular response to reti
noic acid
IEA biological process
GO:0072604 interleukin-6 secretion
IDA biological process
GO:0072606 interleukin-8 secretion
IDA biological process
GO:0090335 regulation of brown fat c
ell differentiation
IEA biological process
GO:0090335 regulation of brown fat c
ell differentiation
ISS biological process
GO:0098868 bone growth
IEA biological process
GO:0098868 bone growth
ISS biological process
GO:1900015 regulation of cytokine pr
oduction involved in infl
ammatory response
IDA biological process
GO:1900180 regulation of protein loc
alization to nucleus
IEA biological process
GO:1900745 positive regulation of p3
8MAPK cascade
IDA biological process
GO:1904651 positive regulation of fa
t cell apoptotic process
IEA biological process
GO:1990051 activation of protein kin
ase C activity
IDA biological process
GO:2000366 positive regulation of ST
AT protein import into nu
cleus
IEA biological process
GO:2000366 positive regulation of ST
AT protein import into nu
cleus
IBA biological process
GO:2000379 positive regulation of re
active oxygen species met
abolic process
IEA biological process
GO:2000486 negative regulation of gl
utamine transport
IEA biological process
GO:2000491 positive regulation of he
patic stellate cell activ
ation
IEA biological process
GO:0001525 angiogenesis
IDA biological process
GO:0001525 angiogenesis
IDA biological process
GO:0001890 placenta development
IDA biological process
GO:0001936 regulation of endothelial
cell proliferation
IDA biological process
GO:0005179 hormone activity
IBA molecular function
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
ISS cellular component
GO:0005615 extracellular space
TAS cellular component
GO:0006112 energy reserve metabolic
process
TAS biological process
GO:0006629 lipid metabolic process
IBA biological process
GO:0007260 tyrosine phosphorylation
of STAT protein
IBA biological process
GO:0008343 adult feeding behavior
ISS biological process
GO:0010507 negative regulation of au
tophagy
IDA biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
ISS biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IDA biological process
GO:0019953 sexual reproduction
IMP biological process
GO:0030217 T cell differentiation
ISS biological process
GO:0032008 positive regulation of TO
R signaling
IDA biological process
GO:0032099 negative regulation of ap
petite
ISS biological process
GO:0032310 prostaglandin secretion
IDA biological process
GO:0032814 regulation of natural kil
ler cell activation
IDA biological process
GO:0032817 regulation of natural kil
ler cell proliferation
IDA biological process
GO:0032868 response to insulin
IBA biological process
GO:0033210 leptin-mediated signaling
pathway
ISS biological process
GO:0033210 leptin-mediated signaling
pathway
ISS biological process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
ISS biological process
GO:0038108 negative regulation of ap
petite by leptin-mediated
signaling pathway
IBA biological process
GO:0042102 positive regulation of T
cell proliferation
IDA biological process
GO:0042269 regulation of natural kil
ler cell mediated cytotox
icity
IDA biological process
GO:0043410 positive regulation of MA
PK cascade
ISS biological process
GO:0043410 positive regulation of MA
PK cascade
IDA biological process
GO:0044320 cellular response to lept
in stimulus
IDA biological process
GO:0045765 regulation of angiogenesi
s
IDA biological process
GO:0046325 negative regulation of gl
ucose import
IDA biological process
GO:0046427 positive regulation of JA
K-STAT cascade
IDA biological process
GO:0046850 regulation of bone remode
ling
ISS biological process
GO:0048639 positive regulation of de
velopmental growth
IDA biological process
GO:0050892 intestinal absorption
IDA biological process
GO:0050999 regulation of nitric-oxid
e synthase activity
IDA biological process
GO:0051428 peptide hormone receptor
binding
IBA molecular function
GO:0051726 regulation of cell cycle
IDA biological process
GO:0051897 positive regulation of pr
otein kinase B signaling
ISS biological process
GO:0072604 interleukin-6 secretion
IDA biological process
GO:0072606 interleukin-8 secretion
IDA biological process
GO:0090335 regulation of brown fat c
ell differentiation
ISS biological process
GO:0098868 bone growth
ISS biological process
GO:1900015 regulation of cytokine pr
oduction involved in infl
ammatory response
IDA biological process
GO:1900745 positive regulation of p3
8MAPK cascade
IDA biological process
GO:1990051 activation of protein kin
ase C activity
IDA biological process
GO:2000366 positive regulation of ST
AT protein import into nu
cleus
IBA biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04152AMPK signaling pathway
hsa04080Neuroactive ligand-receptor interaction
hsa04060Cytokine-cytokine receptor interaction
hsa04920Adipocytokine signaling pathway
hsa04932Non-alcoholic fatty liver disease
Associated diseases References
Cancer GAD: 12712467
Cancer (bladder) GAD: 19692168
Cancer (colon) GAD: 18992263
Cancer (colorectal) GAD: 19273568
Cancer (endometrial) GAD: 19886360
Cancer (esophageal) GAD: 18398047
Cancer (lung) GAD: 16630717
Cancer (lymphoma) GAD: 15159310
Cancer (prostate) GAD: 15042602
Cancer (Squamous cell) GAD: 18855010
Cancer (breast) GAD: 12712467
Hypertension GAD: 12050272
Cardiovascular disease GAD: 16261186
Behcet's disease GAD: 16786343
Multiple sclerosis GAD: 19604093
Psoriasis GAD: 18173522
Asthma GAD: 19191138
Churg-Strauss Syndrome GAD: 20185531
Diabetes GAD: 12732844
Fatty liver GAD: 20492333
Insulin resistance GAD: 10490782
Metabolic syndrome GAD: 15978856
Obesity GAD: 12187394
Dyslipidemias GAD: 18725053
Bone diseases GAD: 19453261
Amyotrophic lateral sclerosis (ALS) GAD: 18608101
Autism GAD: 19058789
Bulimia GAD: 20468064
Depression GAD: 19382181
Eating disorders GAD: 17192493
Eating disorders GAD: 17192493
Psychological disorders GAD: 19086053
Schizophrenia GAD: 18681781
Several psychiatric disorders GAD: 19086053
Attention deficit disorder conduct disorder oppositional defiant disorder GAD: 11140838
Albuminuria GAD: 20140086
Kidney diseases GAD: 18242170
HELLP Syndrome GAD: 19634986
Preeclampsia GAD: 15544427
Amenorrhoea INFBASE: 22252944
Pelvic endometriosis INFBASE: 20504092
Infertility INFBASE: 20504092
Defective endometrial receptivity INFBASE: 25935494
Endometrial receptivity INFBASE: 25450293
Endometriosis INFBASE: 20047585
Endometriosis-associated infertility INFBASE: 20825374
Enhanced fertility INFBASE: 24215851
Female infertility INFBASE: 21848410
Hypogonadotropic hypogonadism INFBASE: 22343341
Recurrent implantation failure (RIF) INFBASE: 26952510
Hypothalamic amenorrhoea INFBASE: 12151434
Primary infertility INFBASE: 18665375
Polycystic ovary syndrome (PCOS) INFBASE: 26051098
Ovarian endometriosis INFBASE: 25797583
Ovarian function INFBASE: 10802080
Ovarian hyperstimulation syndrome (OHSS) INFBASE: 15374699
Recurrent pregnancy loss (RPL) INFBASE: 26952510
Premature ovarian failure (POF) INFBASE: 19609224
Polycystic ovary syndrome (PCOS) INFBASE: 10561001
Ovarian endometriosis INFBASE: 19544117
Unexplained infertility INFBASE: 17485120
Endometriosis INFBASE: 15465848
Hypergonadotropic hypogonadism MIK: 12950408
Asthenozoospermia MIK: 25419396
Leukocytospermia MIK: 25081128
Obstructive azoospermia MIK: 17212806
Male factor infertility MIK: 15944217
Varicocele MIK: 25081128
Sertoli cell only syndrome (SCOS) MIK: 17212806
Oligozoospermia MIK: 17714215
Azoospermia MIK: 21735645
Chorioamnionitis GAD: 20452482
Chronic endometritis  INFBASE: 26952510
Chronic obstructive pulmonary disease (COPD) GAD: 19625176
Chronic renal failure GAD: 21085059
Azoospermia MIK: 16025864
Hypergonadotrophic hypogonadism MIK: 12950408
Asthenozoospermia MIK: 25419396
Male infertility MIK: 21777525
Obstructive azoospermia MIK: 17212806
Sertoli cell-only syndrome (SCO) MIK: 17212806
Oligospermia MIK: 17212806
Varicocele MIK: 17212806
Teratozoospermia MIK: 17327269
Leucocytospermia MIK: 25081128

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
15944217 Male infer
tility


Male infertility
Show abstract
25419396 Idiopathic
asthenozo
ospermia

156 (79 astheno
zoospermic men,
77 normozoospe
rmic men)
Male infertility
Show abstract
25081128 Varicocele
, leucocyt
ospermia

184 (74 varicoc
ele (VC) patien
ts, 70 leucocyt
ospermia patien
ts, 40 normospe
rmic men as con
trols)
Male infertility LEP
TNF-?
Show abstract
21777525 Male infer
tility

154 (24 fertile
, 19 polyzoospe
rmic, 26 terato
zoospermic, 27
astheno-teratoz
oospermic, 18 o
ligozoospermic,
18 oligo-asthe
no-teratozoospe
rmic, 11 obstru
ctive azoosperm
ic, 11 non-obst
ructive azoospe
rmic)
Male infertility
Show abstract
21735645 Azoospermi
a

116 (45 patient
s with diagnose
d OA, 41 with u
nexplained NOA
and 30 men with
normal semen p
arameters as co
ntrols)
Male infertility
Show abstract
17714215 Oligozoosp
ermia, Mal
e infertil
ity

80 (30 fertile
normozoospermia
as a control,
50 infertile ol
igozoospermia)
Male infertility
Show abstract
17212806 Obstructiv
e azoosper
mia, Serto
li cell-on
ly syndrom
e (SCO), o
ligospermi
a, varicoc
ele

51(5 fertile vo
lunteers, 8 wit
h obstructive a
zoospermia (OA)
, 6 with Sertol
i cell-only syn
drome (SCO), 32
oligospermic p
atients with va
ricocele testis
)
Male infertility
Show abstract
17209884 Male infer
tility

210 (42 men wit
h non-obstructi
ve azoospermia,
15 men with ob
structive azoos
permia, 68 men
with oligoasthe
noteratozoosper
mia and 85 men
with normozoosp
ermia)
Male infertility
Show abstract
12950408 Hypergonad
otrophic h
ypogonadis
m


Male infertility
Show abstract
16025864 Azoospermi
a

25 (20 azoosper
mic infertile m
en, 5 fertile p
atients)
Male infertility LEP
Show abstract
27813378 Idiopathic
male infe
rtility
rs10244329 Sloveni
an, Ser
bia and
Macedo
nia
981 (572 infert
ile patietns, 4
09 controls)
Male infertility
Show abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract