• Gene id: 3950

Gene Summary

• Gene Symbol: LECT2   Gene   UCSC   Ensembl
• Aliases: chm-II, chm2
• Gene name: leukocyte cell derived chemotaxin 2
• Alternate names: leukocyte cell-derived chemotaxin-2, chondromodulin-II,
• Gene location: 5q31.1 (179864549: 179441981)     Exons: 25     NC_000002.12
• Gene summary(Entrez): This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-indu
• OMIM: 602882

Protein Summary

• Protein general information: O14960  
  • Name: Leukocyte cell derived chemotaxin 2 (LECT 2) (hLECT2)
  • Length: 151  
  • Mass: 16390
  • Tissue specificity: Highly expressed in adult and fetal liver and weakly in testis. Not expressed in bone marrow. {ECO
• Sequence:

  MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIV
  GQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAY
  L

• Structural information:
  • Interpro: IPR011055  IPR008663  IPR017381  IPR016047  
  • PDB: 5B0H
  • PDBsum: 5B0H
  • STRING: ENSP00000274507
• Other Databases: GeneCards:  LECT2  Malacards:  LECT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001501	skeletal system development	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R