• Gene id: 3948

Gene Summary

• Gene Symbol: LDHC   Gene   UCSC   Ensembl
• Aliases: CT32, LDH3, LDHX
• Gene name: lactate dehydrogenase C
• Alternate names: L-lactate dehydrogenase C chain, LDH testis subunit, LDH-C, LDH-X, cancer/testis antigen 32, lactate dehydrogenase C4, lactate dehydrogenase c variant 1, lactate dehydrogenase c variant 3, lactate dehydrogenase c variant 4, lactate dehydrogenase c variant,
• Gene location: 11p15.1 (18412297: 18451245)     Exons: 8     NC_000011.10
• Gene summary(Entrez): Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected wh
• OMIM: 150150

Protein Summary

• Protein general information: P07864  
  • Name: L lactate dehydrogenase C chain (LDH C) (EC 1.1.1.27) (Cancer/testis antigen 32) (CT32) (LDH testis subunit) (LDH X)
  • Length: 332  
  • Mass: 36,311
• Sequence:

  MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTS
  KITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKI
  SGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKE
  HWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGV
  SDVVKINLNSEEEALFKKSAETLWNIQKDLIF

• Structural information:
  • Interpro: IPR001557  IPR011304  IPR018177  IPR022383  IPR001236   IPR015955  IPR036291  
  • Prosite: PS00064
  • STRING: ENSP00000280704
• Other Databases: GeneCards:  LDHC  Malacards:  LDHC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004459	L-lactate dehydrogenase activity	EXP	molecular function
GO:0004459	L-lactate dehydrogenase activity	EXP	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0006090	pyruvate metabolic process	TAS	biological process
GO:0006754	ATP biosynthetic process	IEA	biological process
GO:0019244	lactate biosynthetic process from pyruvate	IEA	biological process
GO:0019516	lactate oxidation	IEA	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0031514	motile cilium	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0004459	L-lactate dehydrogenase activity	IEA	molecular function
GO:0004459	L-lactate dehydrogenase activity	IEA	molecular function
GO:0004459	L-lactate dehydrogenase activity	IEA	molecular function
GO:0004459	L-lactate dehydrogenase activity	EXP	molecular function
GO:0004459	L-lactate dehydrogenase activity	EXP	molecular function
GO:0004459	L-lactate dehydrogenase activity	TAS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0006090	pyruvate metabolic process	IEA	biological process
GO:0006090	pyruvate metabolic process	TAS	biological process
GO:0006754	ATP biosynthetic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA	molecular function
GO:0019244	lactate biosynthetic process from pyruvate	IEA	biological process
GO:0019516	lactate oxidation	IEA	biological process
GO:0019752	carboxylic acid metabolic process	IEA	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0031514	motile cilium	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0004459	L-lactate dehydrogenase activity	EXP	molecular function
GO:0004459	L-lactate dehydrogenase activity	EXP	molecular function
GO:0004459	L-lactate dehydrogenase activity	TAS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006090	pyruvate metabolic process	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04066	HIF-1 signaling pathway
hsa04922	Glucagon signaling pathway
hsa05230	Central carbon metabolism in cancer

Diseases

Associated diseases	References
Sperm concentration	MIK: 2496674
Sperm density	MIK: 8270304
Impaired sperm motility	MIK: 14985855
Male factor infertility	MIK: 3403363
Oligozoospermia	MIK: 1879960
Azoospermia	MIK: 8270304
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Impaired sperm motility	MIK: 14985855
Male infertility	MIK: 3403363
Oligozoospermia	MIK: 1879960
Plays an essential role in maintenance of the processes of glycolysis and ATP production in the flagellum that are required for male fertility and sperm function	MIK: 18367675
Plays an important metabolic role in sperm capacitation	MIK: 15051959
Sperm concentration	MIK: 2496674
Sperm density	MIK: 8270304
Azoospermia	MIK: 8270304
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
14985855	Impaired sperm motility			53 (29 normal, 24 motility impaired)	Male infertility	TPX-1 LDHC
2496674	Sperm concentration, male infertility			78 (68 infertile men, 10 fertile men)	Male infertility	LDH1 LDH2 LDH3 LDH4 LDH5 and LDHx
1879960	Oligozoospermic			222 (74 oligozoospermic patients, 148 normospermic men)	Male infertility	LDH LDH-X
3403363	Male infertility			60 samples	Male infertility	Transferrin LDH-X
8270304	Sperm density, azoospermia				Male infertility	LDH-x
18367675	Plays an essential role in maintenance of the processes of glycolysis and ATP production in the flagellum that are required for male fertility and sperm function				Male infertility
15051959	Plays an important metabolic role in sperm capacitation				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R