• Gene id: 3945

Gene Summary

• Gene Symbol: LDHB   Gene   UCSC   Ensembl
• Aliases: HEL-S-281, LDH-B, LDH-H, LDHBD, TRG-5
• Gene name: lactate dehydrogenase B
• Alternate names: L-lactate dehydrogenase B chain, LDH heart subunit, epididymis secretory protein Li 281, lactate dehydrogenase H chain, renal carcinoma antigen NY-REN-46, testicular secretory protein Li 25,
• Gene location: 12p12.1 (21657970: 21635341)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have bee
• OMIM: 150100

Protein Summary

• Protein general information: P07195  
  • Name: L lactate dehydrogenase B chain (LDH B) (EC 1.1.1.27) (LDH heart subunit) (LDH H) (Renal carcinoma antigen NY REN 46)
  • Length: 334  
  • Mass: 36638
• Sequence:

  MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQT
  PKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWK
  LSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDS
  ENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
  LTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

• Structural information:
  • Interpro: IPR001557  IPR011304  IPR018177  IPR022383  IPR001236   IPR015955  IPR036291  
  • Prosite: PS00064
  • PDB: 1I0Z 1T2F
  • PDBsum: 1I0Z 1T2F
  • STRING: ENSP00000379386
• Other Databases: GeneCards:  LDHB  Malacards:  LDHB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004459	L-lactate dehydrogenase activity	IBA	molecular function
GO:0004459	L-lactate dehydrogenase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0019752	carboxylic acid metabolic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004459	L-lactate dehydrogenase activity	TAS	molecular function
GO:0004459	L-lactate dehydrogenase activity	IEA	molecular function
GO:0006090	pyruvate metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04922	Glucagon signaling pathway
hsa04066	HIF-1 signaling pathway
hsa00010	Glycolysis / Gluconeogenesis
hsa05230	Central carbon metabolism in cancer
hsa00270	Cysteine and methionine metabolism
hsa00620	Pyruvate metabolism
hsa00640	Propanoate metabolism

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray