• Gene id: 394263

Gene Summary

• Gene Symbol: MUC21   Gene   UCSC   Ensembl
• Aliases: C6orf205, KMQK697, MUC-21
• Gene name: mucin 21, cell surface associated
• Alternate names: mucin-21, epiglycanin,
• Gene location: 6p21.33 (30983717: 30989902)     Exons: 22     NC_000006.12
• Gene summary(Entrez): This gene encodes a large membrane-bound glycoprotein which is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in in
• OMIM: 616991

Protein Summary

• Protein general information: Q5SSG8  
  • Name: Mucin 21 (MUC 21) (Epiglycanin)
  • Length: 566  
  • Mass: 54228
  • Tissue specificity: Expressed in lung, large intestine, thymus, and testis. Expressed in normal and malignant bronchial epithelial cells. {ECO
• Sequence:

  MKMQKGNVLLMFGLLLHLEAATNSNETSTSANTGSSVISSGASTATNSGSSVTSSGVSTATISGSSVTSNGVSIV
  TNSEFHTTSSGISTATNSEFSTVSSGISIATNSESSTTSSGASTATNSESSTPSSGASTATNSDSSTTSSGASTA
  TNSDSSTTSSEASTATNSESSTTSSGASTATNSESSTVSSRASTATNSESSTTSSGASTATNSESRTTSNGAGTA
  TNSESSTTSSGASTATNSESSTPSSGAGTATNSESSTTSSGAGTATNSESSTVSSGISTVTNSESSTPSSGANTA
  TNSESSTTSSGANTATNSDSSTTSSGASTATNSESSTTSSGASTATNSESSTTSSGASTATNSGSSTTSSGTSTA
  TNSESSTVSSGASTATTSESSTTSSGASTATNSESSTVSSGASTATNSESSTTSSGANTATNSGSSVTSAGSGTA
  ALTGMHTTSHSASTAVSEAKPGGSLVPWEIFLITLVSVVAAVGLFAGLFFCVRNSLSLRNTFNTAVYHPHGLNHG
  LGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNSGP

• Structural information:
  • Interpro: IPR033534  IPR028199  IPR008519  
  • STRING: ENSP00000365473
• Other Databases: GeneCards:  MUC21  Malacards:  MUC21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022408	negative regulation of cell-cell adhesion	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007162	negative regulation of cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0016266	O-glycan processing	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Asthenoozoospermia	MIK: 32167074
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
32167074	Asthenoozoospermia			12 (6controls, 6 cases)	Male infertility	Microarray