• Gene id: 3936

Gene Summary

• Gene Symbol: LCP1   Gene   UCSC   Ensembl
• Aliases: CP64, HEL-S-37, L-PLASTIN, LC64P, LPL, PLS2
• Gene name: lymphocyte cytosolic protein 1
• Alternate names: plastin-2, L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (LC64P), LCP-1, Lymphocyte cytosolic protein-1 (plasmin), bA139H14.1 (lymphocyte cytosolic protein 1 (L-plastin)), epididymis secretory protein Li 37,
• Gene location: 13q14.13 (46182176: 46125922)     Exons: 17     NC_000013.11
• Gene summary(Entrez): Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as
• OMIM: 605699

Protein Summary

• Protein general information: P13796  
  • Name: Plastin 2 (L plastin) (LC64P) (Lymphocyte cytosolic protein 1) (LCP 1)
  • Length: 627  
  • Mass: 70288
  • Tissue specificity: Detected in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia, in spleen and other lymph node-containing organs. Expressed in peripheral blood T-lymphocytes, neutrophils, monocytes, B-lymphocytes, and myeloid cells
• Sequence:

  MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFI
  KIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNT
  NDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVL
  GLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCNKIGNFSTDIKDSKAYY
  HLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNPKLNLAFIANLFNRYP
  ALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKL
  GGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWV
  NETLREAKKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYAL
  PEDLVEVNPKMVMTVFACLMGKGMKRV

• Structural information:
  • Protein Domains: (9..4-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (49..8-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (120..23-)
    1 (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE--)
  • Interpro: IPR001589  IPR001715  IPR036872  IPR011992  IPR018247   IPR002048  IPR039959  IPR039956  
  • Prosite: PS00019 PS00020 PS50021 PS00018 PS50222
  • CDD: cd00014 cd00051
  • PDB: 2D85 5JOJ 5JOL
  • PDBsum: 2D85 5JOJ 5JOL
  • DIP: 34767
  • STRING: ENSP00000381581
• Other Databases: GeneCards:  LCP1  Malacards:  LCP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048471	perinuclear region of cytoplasm	IDA	colocalizes with
GO:0051015	actin filament binding	ISS	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0001726	ruffle	ISS	cellular component
GO:0001891	phagocytic cup	ISS	cellular component
GO:0005884	actin filament	ISS	cellular component
GO:0051017	actin filament bundle assembly	ISS	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005884	actin filament	IBA	cellular component
GO:0032432	actin filament bundle	IBA	cellular component
GO:0051017	actin filament bundle assembly	IBA	biological process
GO:0051639	actin filament network formation	IBA	biological process
GO:0033157	regulation of intracellular protein transport	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0002286	T cell activation involved in immune response	IDA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0051015	actin filament binding	IEA	molecular function
GO:0051017	actin filament bundle assembly	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0035722	interleukin-12-mediated signaling pathway	TAS	biological process
GO:0030054	cell junction	TAS	cellular component
GO:0051015	actin filament binding	IEA	molecular function
GO:0001891	phagocytic cup	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0051017	actin filament bundle assembly	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0005884	actin filament	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031100	animal organ regeneration	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0032587	ruffle membrane	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0002102	podosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051015	actin filament binding	IMP	molecular function
GO:0030175	filopodium	IMP	cellular component
GO:0016477	cell migration	IMP	biological process
GO:0010737	protein kinase A signaling	IMP	biological process
GO:0001726	ruffle	IMP	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051017	actin filament bundle assembly	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0044319	wound healing, spreading of cells	IMP	NOT|biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0032432	actin filament bundle	IMP	cellular component
GO:0005925	focal adhesion	IMP	cellular component
GO:0005884	actin filament	IMP	cellular component
GO:0001725	stress fiber	IMP	colocalizes with
GO:0005615	extracellular space	HDA	cellular component
GO:0071803	positive regulation of podosome assembly	IMP	biological process
GO:0005509	calcium ion binding	NAS	molecular function
GO:0003779	actin binding	NAS	molecular function
GO:0022617	extracellular matrix disassembly	IMP	biological process
GO:0051020	GTPase binding	IPI	molecular function
GO:0005737	cytoplasm	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881