• Gene id: 3933

Gene Summary

• Gene Symbol: LCN1   Gene   UCSC   Ensembl
• Aliases: PMFA, TLC, TP, VEGP
• Gene name: lipocalin 1
• Alternate names: lipocalin-1, VEG protein, Von Ebner gland protein, protein migrating faster than albumin, tear prealbumin,
• Gene location: 9q34.3 (135521295: 135526539)     Exons: 7     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the lipocalin family of small secretory proteins. Lipocalins are extracellular transport proteins that bind to a variety of hydrophobic ligands. The encoded protein is the primary lipid binding protein in tears and is overpro
• OMIM: 151675

Protein Summary

• Protein general information: P31025  
  • Name: Lipocalin 1 (Tear lipocalin) (Tlc) (Tear prealbumin) (TP) (von Ebner gland protein) (VEG protein)
  • Length: 176  
  • Mass: 19,250
• Sequence:

  MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLI
  SGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEK
  AAGARGLSTESILIPRQSETCSPGSD

• Structural information:
  • Interpro: IPR012674  IPR002345  IPR000566  IPR002450  
  • PDB: 1XKI 3EYC 4QAF 5T43
  • PDBsum: 1XKI 3EYC 4QAF 5T43
  • STRING: ENSP00000263598
• Other Databases: GeneCards:  LCN1  Malacards:  LCN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001895	retina homeostasis	IEP	biological process
GO:0004869	cysteine-type endopeptidase inhibitor activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0015909	long-chain fatty acid transport	TAS	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0001895	retina homeostasis	IEP	biological process
GO:0004869	cysteine-type endopeptidase inhibitor activity	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0006810	transport	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0015909	long-chain fatty acid transport	TAS	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0001895	retina homeostasis	IEP	biological process
GO:0004869	cysteine-type endopeptidase inhibitor activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0015909	long-chain fatty acid transport	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Alzheimer's disease	GAD: 19141999
Oligoasthenozoospermia	MIK: 25779018
Male factor infertility	MIK: 25779018
Oligoasthenozoospermia	MIK: 25779018
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25779018	Oligoasthenozoospermia			20 (10 men with normozoospermia, 10 men with idiopathic oligoasthenozoospermia)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)