• Gene id: 3932

Gene Summary

• Gene Symbol: LCK   Gene   UCSC   Ensembl
• Aliases: IMD22, LSK, YT16, p56lck, pp58lck
• Gene name: LCK proto-oncogene, Src family tyrosine kinase
• Alternate names: tyrosine-protein kinase Lck, T-lymphocyte specific protein tyrosine kinase p56lck, leukocyte C-terminal Src kinase, lymphocyte cell-specific protein-tyrosine kinase, p56(LSTRA) protein-tyrosine kinase, proto-oncogene tyrosine-protein kinase LCK, t cell-specific,
• Gene location: 1p35.2 (32251264: 32286166)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK doma
• OMIM: 139260

Protein Summary

• Protein general information: P06239  
  • Name: Tyrosine protein kinase Lck (EC 2.7.10.2) (Leukocyte C terminal Src kinase) (LSK) (Lymphocyte cell specific protein tyrosine kinase) (Protein YT16) (Proto oncogene Lck) (T cell specific protein tyrosine kinase) (p56 LCK)
  • Length: 509  
  • Mass: 58001
  • Tissue specificity: Expressed specifically in lymphoid cells.
• Sequence:

  MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPS
  HDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGS
  FLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQ
  TQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
  VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDT
  LSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVI
  QNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP

• Structural information:
  • Protein Domains: (61..12-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (127..22-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (245..49-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR035850  IPR035749  IPR000719  IPR017441   IPR001245  IPR000980  IPR036860  IPR036028  IPR001452  IPR008266  IPR020635  
  • Prosite: PS00107 PS50011 PS00109 PS50001 PS50002
  • CDD: cd10362 cd12005
  • PDB: 1BHF 1BHH 1CWD 1CWE 1FBZ 1H92 1IJR 1KIK 1LCJ 1LCK 1LKK 1LKL 1Q68 1Q69 1QPC 1QPD 1QPE 1QPJ 1X27 2IIM 2OF2 2OF4 2OFU 2OFV 2OG8 2PL0 2ZM1 2ZM4 2ZYB 3AC1 3AC2 3AC3 3AC4 3AC5 3AC8 3ACJ 3ACK 3AD4 3AD5 3AD6 3B2W 3BRH 3BYM 3BYO 3BYS 3BYU 3KMM 3KXZ 3LCK 3MPM 4C3F 4D8K 5MTM 5MTN 6H6A 6PDJ
  • PDBsum: 1BHF 1BHH 1CWD 1CWE 1FBZ 1H92 1IJR 1KIK 1LCJ 1LCK 1LKK 1LKL 1Q68 1Q69 1QPC 1QPD 1QPE 1QPJ 1X27 2IIM 2OF2 2OF4 2OFU 2OFV 2OG8 2PL0 2ZM1 2ZM4 2ZYB 3AC1 3AC2 3AC3 3AC4 3AC5 3AC8 3ACJ 3ACK 3AD4 3AD5 3AD6 3B2W 3BRH 3BYM 3BYO 3BYS 3BYU 3KMM 3KXZ 3LCK 3MPM 4C3F 4D8K 5MTM 5MTN 6H6A 6PDJ
  • DIP: 553
  • STRING: ENSP00000337825
• Other Databases: GeneCards:  LCK  Malacards:  LCK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0030217	T cell differentiation	IBA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IBA	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0050853	B cell receptor signaling pathway	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0001772	immunological synapse	IDA	cellular component
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0031295	T cell costimulation	TAS	biological process
GO:0031295	T cell costimulation	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045121	membrane raft	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1903039	positive regulation of leukocyte cell-cell adhesion	IMP	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IMP	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0001784	phosphotyrosine residue binding	IPI	molecular function
GO:0004713	protein tyrosine kinase activity	IMP	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IMP	biological process
GO:0042608	T cell receptor binding	IPI	molecular function
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0000242	pericentriolar material	IDA	cellular component
GO:0050870	positive regulation of T cell activation	IDA	biological process
GO:0042493	response to drug	IDA	biological process
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050862	positive regulation of T cell receptor signaling pathway	NAS	biological process
GO:0043548	phosphatidylinositol 3-kinase binding	IPI	molecular function
GO:0051209	release of sequestered calcium ion into cytosol	ISS	biological process
GO:0051117	ATPase binding	IPI	molecular function
GO:0042610	CD8 receptor binding	IPI	molecular function
GO:0042169	SH2 domain binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0051249	regulation of lymphocyte activation	NAS	biological process
GO:0042609	CD4 receptor binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0006882	cellular zinc ion homeostasis	IEP	biological process
GO:0042169	SH2 domain binding	IPI	molecular function
GO:0030217	T cell differentiation	IMP	biological process
GO:0030097	hemopoiesis	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa04380	Osteoclast differentiation
hsa05135	Yersinia infection
hsa04650	Natural killer cell mediated cytotoxicity
hsa04064	NF-kappa B signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04659	Th17 cell differentiation
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04658	Th1 and Th2 cell differentiation
hsa05340	Primary immunodeficiency

Diseases

Associated diseases	References
Combined immunodeficiency	KEGG:H00093
Combined immunodeficiency	KEGG:H00093
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881