• Gene id: 3931

Gene Summary

• Gene Symbol: LCAT   Gene   UCSC   Ensembl
• Gene name: lecithin-cholesterol acyltransferase
• Alternate names: phosphatidylcholine-sterol acyltransferase, phosphatidylcholine--sterol O-acyltransferase, phospholipid-cholesterol acyltransferase, testicular secretory protein Li 24,
• Gene location: 16q22.1 (67944119: 67939749)     Exons: 6     NC_000016.10
• Gene summary(Entrez): This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as
• OMIM: 611049

Protein Summary

• Protein general information: P04180  
  • Name: Phosphatidylcholine sterol acyltransferase (EC 2.3.1.43) (Lecithin cholesterol acyltransferase) (Phospholipid cholesterol acyltransferase)
  • Length: 440  
  • Mass: 49578
  • Tissue specificity: Detected in blood plasma (PubMed
• Sequence:

  MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKLDKPDVVNWMCY
  RKTEDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSKLAGYLHTLVQ
  NLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQPQAWKDR
  FIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGR
  DFQRFFADLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPRTYIYDHGFPYTDPVGVLYEDGDDTVATR
  STELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHINAILLGAYRQGPPASPTASPEPPPPE

• Structural information:
  • Interpro: IPR029058  IPR003386  
  • Prosite: PS00120
  • PDB: 4X96 4XWG 4XX1 5BV7 5TXF 6MVD
  • PDBsum: 4X96 4XWG 4XX1 5BV7 5TXF 6MVD
  • DIP: 29620
  • STRING: ENSP00000264005
• Other Databases: GeneCards:  LCAT  Malacards:  LCAT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IDA	cellular component
GO:0047179	platelet-activating factor acetyltransferase activity	IDA	molecular function
GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity	IDA	molecular function
GO:0046470	phosphatidylcholine metabolic process	IDA	biological process
GO:0034435	cholesterol esterification	IDA	biological process
GO:0008203	cholesterol metabolic process	IDA	biological process
GO:0004607	phosphatidylcholine-sterol O-acyltransferase activity	IDA	molecular function
GO:0034435	cholesterol esterification	IDA	biological process
GO:0006656	phosphatidylcholine biosynthetic process	IMP	biological process
GO:0008374	O-acyltransferase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0008202	steroid metabolic process	IEA	biological process
GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity	IEA	molecular function
GO:0004607	phosphatidylcholine-sterol O-acyltransferase activity	IEA	molecular function
GO:0030301	cholesterol transport	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0008203	cholesterol metabolic process	IDA	biological process
GO:0004607	phosphatidylcholine-sterol O-acyltransferase activity	IDA	molecular function
GO:0004607	phosphatidylcholine-sterol O-acyltransferase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0034375	high-density lipoprotein particle remodeling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0042158	lipoprotein biosynthetic process	IEA	biological process
GO:0090107	regulation of high-density lipoprotein particle assembly	IEA	biological process
GO:0004607	phosphatidylcholine-sterol O-acyltransferase activity	IEA	molecular function
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0004607	phosphatidylcholine-sterol O-acyltransferase activity	IDA	molecular function
GO:0034186	apolipoprotein A-I binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0006656	phosphatidylcholine biosynthetic process	IDA	biological process
GO:0034372	very-low-density lipoprotein particle remodeling	IDA	biological process
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological process
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological process
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological process
GO:0042632	cholesterol homeostasis	IDA	biological process
GO:0043691	reverse cholesterol transport	IDA	biological process
GO:0008203	cholesterol metabolic process	IDA	biological process
GO:0034364	high-density lipoprotein particle	IDA	cellular component
GO:0034435	cholesterol esterification	IDA	biological process
GO:0034435	cholesterol esterification	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004607	phosphatidylcholine-sterol O-acyltransferase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa00564	Glycerophospholipid metabolism
hsa04979	Cholesterol metabolism

Diseases

Associated diseases	References
Lecithin:cholesterol acyltransferase deficiency	KEGG:H00158
Lecithin:cholesterol acyltransferase deficiency	KEGG:H00158
Norum disease	PMID:16061733
Arteriosclerosis	PMID:12673583
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R