• Gene id: 3929

Gene Summary

• Gene Symbol: LBP   Gene   UCSC   Ensembl
• Aliases: BPIFD2
• Gene name: lipopolysaccharide binding protein
• Alternate names: lipopolysaccharide-binding protein, BPI fold containing family D, member 2, LPS-binding protein,
• Gene location: 20q11.23 (38346481: 38377012)     Exons: 15     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeab

Protein Summary

• Protein general information: P18428  
  • Name: Lipopolysaccharide binding protein (LBP)
  • Length: 481  
  • Mass: 53384
  • Tissue specificity: Detected in blood serum (at protein level). {ECO
• Sequence:

  MGALARALPSILLALLLTSTPEALGANPGLVARITDKGLQYAAQEGLLALQSELLRITLPDFTGDLRIPHVGRGR
  YEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRKSFFKLQGSFDVSVKGISISVNLLLGSESSG
  RPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSF
  ADIDYSLVEAPRATAQMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLN
  FSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSK
  EPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL
  PLLKRVQLYDLGLQIHKDFLFLGANVQYMRV

• Structural information:
  • Interpro: IPR017943  IPR030675  IPR032942  IPR030180  IPR001124   IPR017954  IPR017942  
  • Prosite: PS00400
  • DIP: 90
  • STRING: ENSP00000217407
• Other Databases: GeneCards:  LBP  Malacards:  LBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0045087	innate immune response	IBA	biological process
GO:0050830	defense response to Gram-positive bacterium	IBA	biological process
GO:0001530	lipopolysaccharide binding	IBA	molecular function
GO:0002281	macrophage activation involved in immune response	IBA	biological process
GO:0006953	acute-phase response	IBA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IBA	biological process
GO:0042535	positive regulation of tumor necrosis factor biosynthetic process	IBA	biological process
GO:0043032	positive regulation of macrophage activation	IBA	biological process
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0002281	macrophage activation involved in immune response	IMP	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IMP	biological process
GO:0001530	lipopolysaccharide binding	IMP	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0001530	lipopolysaccharide binding	IEA	molecular function
GO:0006953	acute-phase response	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0070891	lipoteichoic acid binding	IDA	molecular function
GO:0071223	cellular response to lipoteichoic acid	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IDA	biological process
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0071723	lipopeptide binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045919	positive regulation of cytolysis	IDA	biological process
GO:0033036	macromolecule localization	IDA	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0034142	toll-like receptor 4 signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0032722	positive regulation of chemokine production	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0002232	leukocyte chemotaxis involved in inflammatory response	IEA	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IEA	biological process
GO:0060265	positive regulation of respiratory burst involved in inflammatory response	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0042535	positive regulation of tumor necrosis factor biosynthetic process	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0006953	acute-phase response	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0002281	macrophage activation involved in immune response	IEA	biological process
GO:0001530	lipopolysaccharide binding	IEA	molecular function
GO:0001530	lipopolysaccharide binding	ISS	molecular function
GO:0005102	signaling receptor binding	ISS	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0008228	opsonization	IC	biological process
GO:0015920	lipopolysaccharide transport	IDA	biological process
GO:0032490	detection of molecule of bacterial origin	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0045087	innate immune response	IC	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0005615	extracellular space	ISS	cellular component
GO:0008228	opsonization	ISS	biological process
GO:0045087	innate immune response	ISS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IDA	biological process
GO:0034145	positive regulation of toll-like receptor 4 signaling pathway	IDA	biological process
GO:0043032	positive regulation of macrophage activation	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0002281	macrophage activation involved in immune response	ISS	biological process
GO:0006953	acute-phase response	ISS	biological process
GO:0006953	acute-phase response	IEP	biological process
GO:0006968	cellular defense response	ISS	biological process
GO:0032760	positive regulation of tumor necrosis factor production	ISS	biological process
GO:0050829	defense response to Gram-negative bacterium	ISS	biological process
GO:0060265	positive regulation of respiratory burst involved in inflammatory response	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis
hsa04064	NF-kappa B signaling pathway
hsa04620	Toll-like receptor signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq