• Gene id: 3925

Gene Summary

• Gene Symbol: STMN1   Gene   UCSC   Ensembl
• Aliases: C1orf215, LAP18, Lag, OP18, PP17, PP19, PR22, SMN
• Gene name: stathmin 1
• Alternate names: stathmin, leukemia-associated phosphoprotein p18, metablastin, oncoprotein 18, phosphoprotein 19, phosphoprotein p19, prosolin, stathmin 1/oncoprotein 18, testicular tissue protein Li 189, transmembrane protein C1orf215,
• Gene location: 1p36.11 (142147121: 142074483)     Exons: 5     NC_000006.12
• Gene summary(Entrez): This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulatio
• OMIM: 151442

Protein Summary

• Protein general information: P16949  
  • Name: Stathmin (Leukemia associated phosphoprotein p18) (Metablastin) (Oncoprotein 18) (Op18) (Phosphoprotein p19) (pp19) (Prosolin) (Protein Pr22) (pp17)
  • Length: 149  
  • Mass: 17303
  • Tissue specificity: Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is read
• Sequence:

  MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEK
  REHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

• Structural information:
  • Protein Domains: (4..14-)
    (/note="SLD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00998"-)
  • Interpro: IPR030514  IPR000956  IPR036002  
  • Prosite: PS00563 PS01041 PS51663
  • STRING: ENSP00000410452
• Other Databases: GeneCards:  STMN1  Malacards:  STMN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051493	regulation of cytoskeleton organization	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0031175	neuron projection development	IBA	biological process
GO:0031110	regulation of microtubule polymerization or depolymerization	IBA	biological process
GO:0015631	tubulin binding	IBA	molecular function
GO:0007019	microtubule depolymerization	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0031110	regulation of microtubule polymerization or depolymerization	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0015631	tubulin binding	IDA	molecular function
GO:0007052	mitotic spindle organization	IDA	biological process
GO:0007019	microtubule depolymerization	IDA	biological process
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007420	brain development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007409	axonogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000281	mitotic cytokinesis	IEA	biological process
GO:0051272	positive regulation of cellular component movement	IEA	biological process
GO:0031115	negative regulation of microtubule polymerization	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000281	mitotic cytokinesis	IMP	biological process
GO:0035024	negative regulation of Rho protein signal transduction	IMP	biological process
GO:0007019	microtubule depolymerization	IMP	biological process
GO:1905098	negative regulation of guanyl-nucleotide exchange factor activity	IMP	biological process
GO:0070495	negative regulation of thrombin-activated receptor signaling pathway	IMP	biological process
GO:0031110	regulation of microtubule polymerization or depolymerization	IMP	biological process
GO:0048012	hepatocyte growth factor receptor signaling pathway	IMP	biological process
GO:0051497	negative regulation of stress fiber assembly	IMP	biological process
GO:0061436	establishment of skin barrier	IMP	biological process
GO:0031115	negative regulation of microtubule polymerization	IMP	biological process
GO:0015631	tubulin binding	IMP	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0009615	response to virus	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
hepatocellular carcinoma	PMID:28982915
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881