• Gene id: 392399

Gene Summary

• Gene Symbol: LCN9   Gene   UCSC   Ensembl
• Aliases: HEL129
• Gene name: lipocalin 9
• Alternate names: epididymal-specific lipocalin-9, MUP-like lipocalin, epididymis luminal protein 129,
• Gene location: 9q34.3 (135663321: 135670730)     Exons: 9     NC_000009.12
• Gene summary(Entrez): Members of the lipocalin family, such as LCN9, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx. Lipocalins generally bind small hydrophobic ligands and transport them to s
• OMIM: 614964

Protein Summary

• Protein general information: Q8WX39  
  • Name: Epididymal specific lipocalin 9 (MUP like lipocalin)
  • Length: 176  
  • Mass: 20285
• Sequence:

  MALLLLSLGLSLIAAQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGSLIFDF
  EYMVQGECVAVVVVCEKTEKNGEYSINYEGQNTVAVSETDYRLFITFHLQNFRNGTETHTLALYETCEKYGLGSQ
  NIIDLTNKDPCYSKHYRSPPRPPMRW

• Structural information:
  • Interpro: IPR012674  IPR002345  IPR022272  IPR000566  IPR002971  
  • Prosite: PS00213
  • STRING: ENSP00000277526
• Other Databases: GeneCards:  LCN9  Malacards:  LCN9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036094	small molecule binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq