• Gene id: 392391

Gene Summary

• Gene Symbol: OR5C1   Gene   UCSC   Ensembl
• Aliases: OR5C2P, OR9-31, OR9-F
• Gene name: olfactory receptor family 5 subfamily C member 1
• Alternate names: olfactory receptor 5C1, hRPK-465_F_21, olfactory receptor 5C2, olfactory receptor 9-F, olfactory receptor, family 5, subfamily C, member 2 pseudogene,
• Gene location: 9q33.2 (122788932: 122789894)     Exons: 1     NC_000009.12
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
• OMIM: 612903

Protein Summary

• Protein general information: Q8NGR4  
  • Name: Olfactory receptor 5C1 (Olfactory receptor 5C2) (Olfactory receptor 9 F) (OR9 F)
  • Length: 320  
  • Mass: 34991
• Sequence:

  MNSENLTRAAVAPAEFVLLGITNRWDLRVALFLTCLPVYLVSLLGNMGMALLIRMDARLHTPMYFFLANLSLLDA
  CYSSAIGPKMLVDLLLPRATIPYTACALQMFVFAGLADTECCLLAAMAYDRYVAIRNPLLYTTAMSQRLCLALLG
  ASGLGGAVSAFVHTTLTFRLSFCRSRKINSFFCDIPPLLAISCSDTSLNELLLFAICGFIQTATVLAITVSYGFI
  AGAVIHMRSVEGSRRAASTGGSHLTAVAMMYGTLIFMYLRPSSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKE
  VKEALRQTWSRFHCPGQGSQ

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000362784
• Other Databases: GeneCards:  OR5C1  Malacards:  OR5C1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004984	olfactory receptor activity	IBA	molecular function
GO:0005549	odorant binding	IBA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007608	sensory perception of smell	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq