• Gene id: 3920

Gene Summary

• Gene Symbol: LAMP2   Gene   UCSC   Ensembl
• Aliases: CD107b, DND, LAMP-2, LAMPB, LGP-96, LGP110
• Gene name: lysosomal associated membrane protein 2
• Alternate names: lysosome-associated membrane glycoprotein 2, CD107 antigen-like family member B,
• Gene location: Xq24 (120469348: 120426147)     Exons: 10     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhes
• OMIM: 309060

Protein Summary

• Protein general information: P13473  
  • Name: Lysosome associated membrane glycoprotein 2 (LAMP 2) (Lysosome associated membrane protein 2) (CD107 antigen like family member B) (LGP 96) (CD antigen CD107b)
  • Length: 410  
  • Mass: 44961
  • Tissue specificity: Isoform LAMP-2A is highly expressed in placenta, lung and liver, less in kidney and pancreas, low in brain and skeletal muscle (PubMed
• Sequence:

  MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYN
  GSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDL
  FRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSV
  NNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVN
  ISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNF
  LVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF

• Structural information:
  • Interpro: IPR018134  IPR002000  
  • Prosite: PS00310 PS00311 PS51407
  • PDB: 2MOF 2MOM
  • PDBsum: 2MOF 2MOM
  • STRING: ENSP00000408411
• Other Databases: GeneCards:  LAMP2  Malacards:  LAMP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017038	protein import	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0098857	membrane microdomain	TAS	colocalizes with
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0031647	regulation of protein stability	IMP	biological process
GO:0005765	lysosomal membrane	IBA	cellular component
GO:0031902	late endosome membrane	IBA	cellular component
GO:0061740	protein targeting to lysosome involved in chaperone-mediated autophagy	IBA	biological process
GO:0097637	integral component of autophagosome membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0009267	cellular response to starvation	IBA	biological process
GO:0072594	establishment of protein localization to organelle	IBA	biological process
GO:0097352	autophagosome maturation	IBA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0061740	protein targeting to lysosome involved in chaperone-mediated autophagy	ISS	biological process
GO:0006605	protein targeting	ISS	biological process
GO:0061740	protein targeting to lysosome involved in chaperone-mediated autophagy	IMP	biological process
GO:0097352	autophagosome maturation	ISS	biological process
GO:0061684	chaperone-mediated autophagy	ISS	biological process
GO:0009267	cellular response to starvation	ISS	biological process
GO:0061684	chaperone-mediated autophagy	IMP	biological process
GO:1905146	lysosomal protein catabolic process	IMP	biological process
GO:0061684	chaperone-mediated autophagy	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0044754	autolysosome	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0031088	platelet dense granule membrane	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0002576	platelet degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0031088	platelet dense granule membrane	TAS	cellular component
GO:0061740	protein targeting to lysosome involved in chaperone-mediated autophagy	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0097637	integral component of autophagosome membrane	IEA	cellular component
GO:0061740	protein targeting to lysosome involved in chaperone-mediated autophagy	IEA	biological process
GO:0050821	protein stabilization	IEA	biological process
GO:0046716	muscle cell cellular homeostasis	IEA	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0006605	protein targeting	IEA	biological process
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:1990836	lysosomal matrix	IEA	cellular component
GO:0061684	chaperone-mediated autophagy	IEA	biological process
GO:0097352	autophagosome maturation	IEA	biological process
GO:0061684	chaperone-mediated autophagy	IEA	biological process
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0009267	cellular response to starvation	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0000421	autophagosome membrane	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0050821	protein stabilization	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa04142	Lysosome

Diseases

Associated diseases	References
Autophagic vacuolar myopathy	KEGG:H01781
Danon disease	KEGG:H00150
Autophagic vacuolar myopathy	KEGG:H01781
Danon disease	KEGG:H00150
hypertrophic cardiomyopathy	PMID:16144992
hypertrophic cardiomyopathy	PMID:15673802
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)