• Gene id: 392

Gene Summary

• Gene Symbol: ARHGAP1   Gene   UCSC   Ensembl
• Aliases: CDC42GAP, RHOGAP, RHOGAP1, p50rhoGAP
• Gene name: Rho GTPase activating protein 1
• Alternate names: rho GTPase-activating protein 1, CDC42 GTPase-activating protein, GTPase-activating protein rhoGAP, GTPase-activating protein rhoOGAP, GTPase-activating protein, Rho, 1, rho-related small GTPase protein activator, rho-type GTPase-activating protein 1,
• Gene location: 11p11.2 (46700659: 46677076)     Exons: 14     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of a large family of proteins that activate Rho-type guanosine triphosphate (GTP) metabolizing enzymes. The encoded protein contains a SRC homology 3 domain and interacts with Bcl-2-associated protein family members. [provided b
• OMIM: 602732

Protein Summary

• Protein general information: Q07960  
  • Name: Rho GTPase activating protein 1 (CDC42 GTPase activating protein) (GTPase activating protein rhoGAP) (Rho related small GTPase protein activator) (Rho type GTPase activating protein 1) (p50 RhoGAP)
  • Length: 439  
  • Mass: 50436
  • Tissue specificity: Ubiquitous.
• Sequence:

  MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEV
  AGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWLRDAYREFDRK
  YKKNIKALYIVHPTMFIKTLLILFKPLISFKFGQKIFYVNYLSELSEHVKLEQLGIPRQVLKYDDFLKSTQKSPA
  TAPKPMPPRPPLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMG
  LPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFL
  VQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL

• Structural information:
  • Protein Domains: (63..21-)
    (/note="CRAL-TRIO-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00056-)
    (244..43-)
    (/note="Rho-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00172"-)
  • Interpro: IPR001251  IPR036865  IPR008936  IPR000198  
  • Prosite: PS50191 PS50238
  • CDD: cd00170
  • PDB: 1AM4 1GRN 1OW3 1RGP 1TX4 2NGR 5M6X 5M70 6R3V
  • PDBsum: 1AM4 1GRN 1OW3 1RGP 1TX4 2NGR 5M6X 5M70 6R3V
  • DIP: 6081
  • STRING: ENSP00000310491
• Other Databases: GeneCards:  ARHGAP1  Malacards:  ARHGAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IEA	biological process
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0007266	Rho protein signal transduction	TAS	biological process
GO:0007264	small GTPase mediated signal transduction	IDA	biological process
GO:0007264	small GTPase mediated signal transduction	IDA	biological process
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:2001136	negative regulation of endocytic recycling	IMP	biological process
GO:0097443	sorting endosome	IMP	colocalizes with
GO:0016197	endosomal transport	IMP	biological process
GO:0010008	endosome membrane	IDA	cellular component
GO:0033572	transferrin transport	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)