• Gene id: 3916

Gene Summary

• Gene Symbol: LAMP1   Gene   UCSC   Ensembl
• Aliases: CD107a, LAMPA, LGP120
• Gene name: lysosomal associated membrane protein 1
• Alternate names: lysosome-associated membrane glycoprotein 1, CD107 antigen-like family member A, LAMP-1, lysosome-associated membrane protein 1,
• Gene location: 13q34 (113297238: 113323671)     Exons: 10     NC_000013.11
• Gene summary(Entrez): The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008]
• OMIM: 600658

Protein Summary

• Protein general information: P11279  
  • Name: Lysosome associated membrane glycoprotein 1 (LAMP 1) (Lysosome associated membrane protein 1) (CD107 antigen like family member A) (CD antigen CD107a)
  • Length: 417  
  • Mass: 44882
• Sequence:

  MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDATVVL
  NRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADID
  KKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVS
  GTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF
  LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEEC
  LLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI

• Structural information:
  • Interpro: IPR018134  IPR002000  
  • Prosite: PS00310 PS00311 PS51407
  • DIP: 44670
  • STRING: ENSP00000333298
• Other Databases: GeneCards:  LAMP1  Malacards:  LAMP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005765	lysosomal membrane	IBA	cellular component
GO:0031902	late endosome membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0072594	establishment of protein localization to organelle	IBA	biological process
GO:0005765	lysosomal membrane	ISS	cellular component
GO:0010008	endosome membrane	ISS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005764	lysosome	TAS	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IMP	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061474	phagolysosome membrane	IEA	cellular component
GO:0050821	protein stabilization	IEA	biological process
GO:0044754	autolysosome	IEA	cellular component
GO:0044194	cytolytic granule	IEA	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005771	multivesicular body	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0048102	autophagic cell death	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0005773	vacuole	IEA	cellular component
GO:0005771	multivesicular body	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0042383	sarcolemma	IEA	cellular component
GO:0031982	vesicle	IEA	cellular component
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0097208	alveolar lamellar body	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	colocalizes with
GO:0005764	lysosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0050821	protein stabilization	ISS	biological process
GO:0008626	granzyme-mediated apoptotic signaling pathway	IMP	biological process
GO:0072594	establishment of protein localization to organelle	IMP	biological process
GO:0090160	Golgi to lysosome transport	IMP	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IMP	biological process
GO:1902513	regulation of organelle transport along microtubule	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0043323	positive regulation of natural killer cell degranulation	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0005765	lysosomal membrane	IBA	cellular component
GO:0031902	late endosome membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0072594	establishment of protein localization to organelle	IBA	biological process
GO:0005765	lysosomal membrane	ISS	cellular component
GO:0010008	endosome membrane	ISS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005764	lysosome	TAS	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IMP	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061474	phagolysosome membrane	IEA	cellular component
GO:0050821	protein stabilization	IEA	biological process
GO:0044754	autolysosome	IEA	cellular component
GO:0044194	cytolytic granule	IEA	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005771	multivesicular body	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0048102	autophagic cell death	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0005773	vacuole	IEA	cellular component
GO:0005771	multivesicular body	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0042383	sarcolemma	IEA	cellular component
GO:0031982	vesicle	IEA	cellular component
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0097208	alveolar lamellar body	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	colocalizes with
GO:0005764	lysosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0050821	protein stabilization	ISS	biological process
GO:0008626	granzyme-mediated apoptotic signaling pathway	IMP	biological process
GO:0072594	establishment of protein localization to organelle	IMP	biological process
GO:0090160	Golgi to lysosome transport	IMP	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IMP	biological process
GO:1902513	regulation of organelle transport along microtubule	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0043323	positive regulation of natural killer cell degranulation	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa04142	Lysosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R