• Gene id: 3915

Gene Summary

• Gene Symbol: LAMC1   Gene   UCSC   Ensembl
• Aliases: LAMB2
• Gene name: laminin subunit gamma 1
• Alternate names: laminin subunit gamma-1, S-LAM gamma, S-laminin subunit gamma, laminin B2 chain, laminin, gamma 1 (formerly LAMB2), laminin-10 subunit gamma, laminin-11 subunit gamma, laminin-2 subunit gamma, laminin-3 subunit gamma, laminin-4 subunit gamma, laminin-6 subunit gamm,
• Gene location: 1q25.3 (26892827: 26840684)     Exons: 7     NC_000009.12
• Gene summary(Entrez): Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, n
• OMIM: 150290

Protein Summary

• Protein general information: P11047  
  • Name: Laminin subunit gamma 1 (Laminin B2 chain) (Laminin 1 subunit gamma) (Laminin 10 subunit gamma) (Laminin 11 subunit gamma) (Laminin 2 subunit gamma) (Laminin 3 subunit gamma) (Laminin 4 subunit gamma) (Laminin 6 subunit gamma) (Laminin 7 subunit gamma) (L
  • Length: 1609  
  • Mass: 177603
  • Tissue specificity: Found in the basement membranes (major component).
• Sequence:

  MRGSHRAAPALRPRGRLWPVLAVLAAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFNVTVVATNTCGTPPEE
  YCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLGKAFDITYVRL
  KFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTL
  EGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEF
  DKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCQDNTD
  GAHCERCRENFFRLGNNEACSSCHCSPVGSLSTQCDSYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPCSCDPS
  GSIDECNIETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDG
  WRAEQRDGSEASLEWSSERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGA
  GLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLAS
  ARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSPCVLCACNGHSETCDPETGVCNCRDNTAGPH
  CEKCSDGYYGDSTAGTSSDCQPCPCPGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLC
  RLCQCSDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNP
  VTGQCECLPHVTGQDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHCERCEVNHFGF
  GPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPACYRLVKDKVADHRVKLQ
  ELESLIANLGTGDEMVTDQAFEDRLKEAEREVMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIE
  ETGNLAEQARAHVENTERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRV
  AKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGDKAVEIYASVAQLS
  PLDSETLENEANNIKMEAENLEQLIDQKLKDYEDLREDMRGKELEVKNLLEKGKTEQQTADQLLARADAAKALAE
  EAAKKGRDTLQEANDILNNLKDFDRRVNDNKTAAEEALRKIPAINQTITEANEKTREAQQALGSAAADATEAKNK
  AHEAERIASAVQKNATSTKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAE
  INARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEAKKQEAAIMDY
  NRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP

• Structural information:
  • Protein Domains: (46..28-)
    (/note="Laminin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00466-)
    (286..34-)
    1 (/note="Laminin-EGF-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00460-)
    (342..39-)
    2 (/note="Laminin-EGF-like)
    (/evidence="ECO:-)
  • Interpro: IPR000742  IPR002049  IPR000034  IPR008211  IPR038684  
  • Prosite: PS00022 PS01186 PS01248 PS50027 PS51115 PS51117
  • PDB: 5XAU
  • PDBsum: 5XAU
  • STRING: ENSP00000258341
• Other Databases: GeneCards:  LAMC1  Malacards:  LAMC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035633	maintenance of blood-brain barrier	NAS	biological process
GO:0007155	cell adhesion	IDA	biological process
GO:0005604	basement membrane	IDA	cellular component
GO:0005201	extracellular matrix structural constituent	IMP	molecular function
GO:0005606	laminin-1 complex	TAS	cellular component
GO:0016477	cell migration	IMP	biological process
GO:0050679	positive regulation of epithelial cell proliferation	TAS	biological process
GO:0022617	extracellular matrix disassembly	IMP	biological process
GO:0065003	protein-containing complex assembly	IDA	biological process
GO:0031581	hemidesmosome assembly	IMP	biological process
GO:0016477	cell migration	IBA	biological process
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0005604	basement membrane	IBA	cellular component
GO:0005201	extracellular matrix structural constituent	IBA	molecular function
GO:0034446	substrate adhesion-dependent cell spreading	IBA	biological process
GO:0009888	tissue development	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005604	basement membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007492	endoderm development	TAS	biological process
GO:0005604	basement membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0031012	extracellular matrix	IEA	cellular component
GO:0005606	laminin-1 complex	IEA	cellular component
GO:0030023	extracellular matrix constituent conferring elasticity	RCA	molecular function
GO:0005604	basement membrane	IDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	ISS	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	ISS	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0043260	laminin-11 complex	TAS	cellular component
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0043259	laminin-10 complex	TAS	cellular component
GO:0005604	basement membrane	IEA	cellular component
GO:0005604	basement membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	NAS	cellular component
GO:0005606	laminin-1 complex	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04510	Focal adhesion
hsa04512	ECM-receptor interaction
hsa05145	Toxoplasmosis
hsa05222	Small cell lung cancer
hsa05146	Amoebiasis
hsa05020	Prion diseases

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881